FUNCTION: REGULATORY PEPTIDE

Found 4,634 peptides

Current Node: Regulatory peptide | Page 9 of 232

Level 2 Subcategories

Biological regulation (2953) Biological modulation (1391) Cell-cell communication (1015) Cell signaling / Growth factor signaling (235) Stimulation activity (92) Chemical communication (67) Activation activity (48) Receptor signaling modulation (4)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
161	MYP_005636	GFADKCCAIGCSKEELAVACLPFVDF	STANDARD	Hormone Endocrine Reproductive regulator Growth regulation Development regulation	Rattus norvegicus [Animal]	YES
162	MYP_005638	DPSQDFMRF	STANDARD	Neuropeptide	Drosophila melanogaster [Animal]	NO
163	MYP_005641	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	STANDARD	Hormone glucagon family	Homo sapiens [Animal]	YES
164	MYP_005679	SVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGAPIAHRDGSSQRPLKKEDNVLVESYQKSLGEADKADVDVLTKAKSQ	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation Receptor modulation ACE inhibitory	Canis lupus familiaris [Animal]	YES
165	MYP_005706	AVITGACDKDVQCGSGTCCAASAWSRNIRFCIPLGNSGEDCHPASHKVPYDGKRLSSLCPCKSGLTCSKSGEKFKCS	STANDARD	Analgesic Pronociceptive Neuropeptide Neuromodulator Myotropic Receptor modulation Immunomodulatory	Bombina variegata [Animal]	YES
166	MYP_005713	YIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDF	STANDARD	Hormone Gastrointestinal Neuropeptide	Macaca fascicularis [Animal]	NO
167	MYP_005762	CDLPQTHNLRNKRALTLLVQMRRLSPLSMQEVGVQEPPLTQEDYLLAVRTYMSSSAKL	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
168	MYP_005826	NYDSENRFDIPKLYPWRAENTELYEDDAQPTNGEEINGFYGKQRENM	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
169	MYP_005854	RLPSYGHSFL	STANDARD	Neuropeptide	not reported [other]	YES
170	MYP_005927	QGPWLEKEEAAYGWMDF	STANDARD	Hormone Endocrine Myotropic Receptor modulation	Equus caballus [Animal]	YES
171	MYP_005985	GLGACRRGWVGHCNDWLNDEYAKKPGYAMPDGYPHNGT	STANDARD	Stimulatory	synthetic construct [Synthetic]	YES
172	MYP_006006	LLALWGPDPAAAFVNQ	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
173	MYP_006033	PLALEGSLQKRGIVEQC	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
174	MYP_006063	YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Reproductive regulator Receptor modulation Feeding regulator	Sus scrofa [Animal]	YES
175	MYP_006073	ALDTLGGFQVHGW	STANDARD	Neuropeptide	Aplysia californica [Animal]	YES
176	MYP_006082	ISNPAATHQDIDFLI	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
177	MYP_006109	ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS	STANDARD	Cytokine Growth factor intercrine beta (chemokine CC) family Chemokine-like	Homo sapiens [Animal]	YES
178	MYP_006123	AVDQDLGPEVPPENVLGALLRV	STANDARD	Neuropeptide	Rattus norvegicus [Animal]	NO
179	MYP_006161	QPSRIHHRSVK	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
180	MYP_006176	QPPLPRY	STANDARD	Neuropeptide	not reported [other]	YES