FUNCTION: REGULATORY PEPTIDE

Found 4,652 peptides

Current Node: Regulatory peptide | Page 9 of 233

Level 2 Subcategories

Biological regulation (2953) Biological modulation (1391) Cell-cell communication (1015) Stimulation activity (92) Activation activity (48) Cell signaling / Growth factor signaling (18) Chemical communication (0) Receptor signaling modulation (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
161	MYP_005636	GFADKCCAIGCSKEELAVACLPFVDF	STANDARD	Hormone Endocrine Reproductive regulator Growth regulation Development regulation	Rattus norvegicus [Animal]	YES
162	MYP_005638	DPSQDFMRF	STANDARD	Neuropeptide Neuromodulator Myotropic Receptor modulation	Drosophila virilis [Animal]	NO
163	MYP_005641	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	STANDARD	Hormone Metabolic	Cavia porcellus [Animal]	YES
164	MYP_005679	SVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGAPIAHRDGSSQRPLKKEDNVLVESYQKSLGEADKADVDVLTKAKSQ	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation Receptor modulation ACE inhibitory	Canis lupus familiaris [Animal]	YES
165	MYP_005706	AVITGACDKDVQCGSGTCCAASAWSRNIRFCIPLGNSGEDCHPASHKVPYDGKRLSSLCPCKSGLTCSKSGEKFKCS	STANDARD	Analgesic Pronociceptive Neuropeptide Neuromodulator Myotropic Receptor modulation Immunomodulatory	Bombina variegata [Animal]	YES
166	MYP_005713	YIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDF	STANDARD	Hormone Gastrointestinal Neuropeptide	Macaca fascicularis [Animal]	NO
167	MYP_005762	CDLPQTHNLRNKRALTLLVQMRRLSPLSMQEVGVQEPPLTQEDYLLAVRTYMSSSAKL	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
168	MYP_005826	NYDSENRFDIPKLYPWRAENTELYEDDAQPTNGEEINGFYGKQRENM	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
169	MYP_005854	RLPSYGHSFL	STANDARD	Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Myotropic Pruriceptive Feeding regulator	Aplysia californica [Animal]	YES
170	MYP_005927	QGPWLEKEEAAYGWMDF	STANDARD	Hormone Endocrine Myotropic Receptor modulation	Equus caballus [Animal]	YES
171	MYP_005985	GLGACRRGWVGHCNDWLNDEYAKKPGYAMPDGYPHNGT	STANDARD	Stimulatory	synthetic construct [Synthetic]	YES
172	MYP_006006	LLALWGPDPAAAFVNQ	STANDARD	Antidiabetic	not reported [other]	NO
173	MYP_006033	PLALEGSLQKRGIVEQC	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
174	MYP_006063	YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Reproductive regulator Receptor modulation Feeding regulator	Bos taurus [Animal]	YES
175	MYP_006073	ALDTLGGFQVHGW	STANDARD	Behavior Regulator	Aplysia californica [Animal]	NO
176	MYP_006082	ISNPAATHQDIDFLI	STANDARD	Antidiabetic	not reported [other]	NO
177	MYP_006109	ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Homo sapiens [Animal]	YES
178	MYP_006123	AVDQDLGPEVPPENVLGALLRV	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Enzyme modulation Ion channel modulation ACE inhibitory	Rattus norvegicus [Animal]	YES
179	MYP_006161	QPSRIHHRSVK	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
180	MYP_006176	QPPLPRY	STANDARD	Neuropeptide	not reported [other]	YES