FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 9 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
161	MYP_002868	FKIGGFIKKAWRSLLA	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
162	MYP_002876	MKILYFLLAVLLTVLQSSLGFMRVPNNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCCRTVYD	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
163	MYP_002878	VAKFLAKFLKKAL	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
164	MYP_002890	PQMVILQLLRFIFRLVWRRH	STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
165	MYP_002901	CREKAKKLFKKILKKL	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	YES
166	MYP_002916	FFLIPKGRRRRRRRR	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
167	MYP_002928	LLAGLAANFLPTIICKISYKC	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
168	MYP_002976	KWKSFXTFKSXKTVLHTLXAISS	NOT STANDARD	Anticancer	not reported [other]	YES
169	MYP_002985	AAAAARRRRXFKX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
170	MYP_003009	MRPEIWIAQEFRRAGDEVNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
171	MYP_003011	YLNRHLHTWI	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
172	MYP_003066	NFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSD	STANDARD	Antiviral Anti-RSV Entry inhibition	synthetic construct [Synthetic]	YES
173	MYP_003154	FLWWLFKWAWK	STANDARD	Antimicrobial	Glandirana rugosa [Animal]	NO
174	MYP_003157	KPKGMTSSQWFKIQHMQPSPQASNSAMKNINKHTKRSKDLNTFLH	STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
175	MYP_003185	RLFRHRFKRVLRL	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
176	MYP_003220	SLFALGNVISA	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	YES
177	MYP_003232	CDTRL	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
178	MYP_003243	FLPLIAGVAANFLPKIFCLISKKC	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	Lithobates vaillanti [Animal]	YES
179	MYP_003247	GLLXRIKTLL	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
180	MYP_003262	KWKLFKKIPLHLAKKF	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Anticancer	synthetic construct [Synthetic]	YES