FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 77 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
1521	MYP_028241	ALQSRLQAL	STANDARD	Anticancer	Homo sapiens [Animal]	NO
1522	MYP_028245	AFLPWHRLF	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
1523	MYP_028264	VASVSVA	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
1524	MYP_028268	KWKLFKKIPHLAKKF	STANDARD	Anticancer	Insecta [Animal]	NO
1525	MYP_028292	XXLPXTX	NOT STANDARD	Antimicrobial Anticancer Immunomodulating	not reported [other]	NO
1526	MYP_028293	LFAQLGP	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
1527	MYP_028317	CHTNGGYCVR	STANDARD	Anticancer	not reported [other]	NO
1528	MYP_028322	GLFLDTLKKFAKAGMEAVTNPK	STANDARD	Antimicrobial Antibacterial	not reported [other]	NO
1529	MYP_028337	KKKKKEGKKQ	STANDARD	Anticancer	not reported [other]	NO
1530	MYP_028378	CTTHWGFTLC	STANDARD	Anticancer Drug Delivery Vehicle Anti-angiogenic Tumor Homing Peptide	not reported [other]	NO
1531	MYP_028387	ATRSYGNGVYCNNSKCWVNWGEAKENIAGIVISGWASGLAGMGH	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive	Enterococcus faecium [Bacterium]	YES
1532	MYP_028391	YSFNSWM	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
1533	MYP_028395	RQIKIWFQNRRMAWKK	STANDARD	Cell-penetrating peptide Cargo delivery	Drosophila melanogaster [Animal]	NO
1534	MYP_028412	VDKPPYFPRPRPPRRIYNR	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
1535	MYP_028423	AAWIPPG	STANDARD	Antimicrobial Anticancer Hemolytic	Plantae [Plant]	NO
1536	MYP_028426	RIHPPPFYPPFRRFL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
1537	MYP_028429	GFQKVKAQALTCLHTVMA	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
1538	MYP_028440	RKKRRQRRRGGG	STANDARD	Cell-penetrating peptide Cargo delivery	Human immunodeficiency virus 1 [Virus]	NO
1539	MYP_028488	ACDCRGDCFC	STANDARD	Antithrombotic	not reported [other]	NO
1540	MYP_028489	RFRRPIRRRPIRPPFYR	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES