FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 74 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
1461	MYP_026884	MKFTATFLMLFIFVLMVEPGECGWKSVFRKAKKVGKTVGGLALDHYLGEQQELDKRAVDEDPSAIVFD	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
1462	MYP_026895	ECDMAFHIY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
1463	MYP_026912	MQDAITAV	STANDARD	Antimicrobial Anticancer	not reported [other]	NO
1464	MYP_026920	WK	STANDARD	Antidiabetic DPP-IV inhibitory	not reported [other]	NO
1465	MYP_026940	GACFSIAHECGA	STANDARD	Anticancer	not reported [other]	NO
1466	MYP_026944	CYTQYRKCQE	STANDARD	Anticancer	not reported [other]	NO
1467	MYP_027012	DFDEIDR	STANDARD	Anticancer	not reported [other]	NO
1468	MYP_027091	XFXLKKK	NOT STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
1469	MYP_027107	CVHAYRA	STANDARD	Antimicrobial Antiviral Anticancer	Sus scrofa [Animal]	NO
1470	MYP_027144	GCRALCYKQRCVTYCRGA	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Antifungal Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
1471	MYP_027146	RKFRWWVIR	STANDARD	Antimicrobial Antibacterial Antifungal	synthetic construct [Synthetic]	YES
1472	MYP_027147	GLRKRLRKFRNKIKK	STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
1473	MYP_027159	KWKSFLKTFKSAKKTVLHTAAKAISS	STANDARD	Antimicrobial Anticancer	PeptideV13K [other]	YES
1474	MYP_027204	SVYDFFVWL	STANDARD	Anticancer	Homo sapiens [Animal]	NO
1475	MYP_027257	CEGSCVFIPCISAIIGCSCSNKVCYKNGSIP	STANDARD	Anticancer	not reported [other]	NO
1476	MYP_027260	MRIHYLLFALLFLFLLPVPGHGGLMNTLQKYYCRVRGGWCAVLSCLPKEEQIGKCSTRGRKCCRRKK	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
1477	MYP_027261	DGVKLCDVPSGTWSGHCGSSSKCSQQCKDREHFAYGGACHYQFPSVKCFCKRQC	STANDARD	Antimicrobial Antibacterial Antifungal Antibiofilm	Heuchera sanguinea [Plant]	YES
1478	MYP_027286	FLGMIPKLIKKLIKAFK	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Antifungal	synthetic construct [Synthetic]	YES
1479	MYP_027309	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	STANDARD	Antimicrobial Antibacterial Anticancer Antiparasitic Antiplasmodial	not reported [other]	YES
1480	MYP_027348	FALGAVTCLIRTKCKVLPKLF	STANDARD	Antimicrobial Antibacterial Antifungal	synthetic construct [Synthetic]	YES