FUNCTION: METABOLIC

Found 3,269 peptides

Current Node: Metabolic | Page 70 of 164

Level 2 Subcategories

Glucose metabolism (680) Appetite and feeding regulation (0) Lipid metabolism (0) Redox / Antioxidant (0) Uric acid metabolism (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
1381	MYP_075085	HAEIN	STANDARD	Antihypertensive	Gallus gallus [Animal]	NO
1382	MYP_075135	PPL	STANDARD	Antihypertensive Enzyme inhibitory ACE inhibitory Antidiabetic DPP-IV inhibitory Anti-aging Collagen boosting	synthetic construct [Synthetic]	NO
1383	MYP_075158	ENVGGPL	STANDARD	Enzyme inhibitory DPP-IV inhibitory Antidiabetic	not reported [other]	NO
1384	MYP_075253	FLPLLALLALWEPKPTQ	STANDARD	Antidiabetic	not reported [other]	NO
1385	MYP_075279	GIPCFPSSLKRLLIIVVVIVLVVVVIVGALLMGL	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
1386	MYP_075320	IAFTSEHSHFSLK	STANDARD	Metabolic	not reported [other]	NO
1387	MYP_075353	MSKFLPLPLMFY	STANDARD	Metabolic regulation Antidiabetic Glucose metabolism Type 2 diabetes-related Signaling peptide Regulatory peptide	not reported [other]	NO
1388	MYP_075356	QVNFTPNWGT	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator	Romalea microptera [Animal]	NO
1389	MYP_075457	ERANSVTWNPHKMMGVPLQC	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Anti-inflammatory Glucose metabolism Signaling peptide Regulatory peptide Immunomodulatory	not reported [other]	NO
1390	MYP_075486	QPLALEGSL	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
1391	MYP_075771	HAEGTYTSDITSYLEGQAAKEFIAWLVNGRG	STANDARD	Hormone Metabolic	Gallus gallus [Animal]	NO
1392	MYP_075919	WI	STANDARD	Antimicrobial Antibacterial Antifungal	Comamonas testosteroni [Bacterium]	YES
1393	MYP_075953	EPSGAGFQ	STANDARD	Enzyme inhibitory DPP-IV inhibitory Antidiabetic	not reported [other]	YES
1394	MYP_075992	VH	STANDARD	Antidiabetic DPP-IV inhibitory	synthetic construct [Synthetic]	YES
1395	MYP_076025	FL	STANDARD	Taste	Bos taurus [Animal]	NO
1396	MYP_076090	HLLIDLTSFLLSLFSLWLSSKPPSKRL	STANDARD	Antidiabetic	not reported [other]	NO
1397	MYP_076168	RNPFVFAPTLLTVAAR	STANDARD	Antidiabetic Enzyme inhibitory	Spirulina platensis,Arthrospira platensis [Bacterium]	NO
1398	MYP_076184	IPW	STANDARD	Metabolic	not reported [other]	NO
1399	MYP_076266	QKWDPPPVSPP	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
1400	MYP_076322	KMYAFTLESV	STANDARD	Antidiabetic	not reported [other]	NO