FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 70 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
1381	MYP_025504	LYQAVATI	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
1382	MYP_025512	NIGDEALIGRW	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
1383	MYP_025529	KGHHGKHG	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
1384	MYP_025552	CGRKKRRQRRPPQ	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
1385	MYP_025556	LRPEIRIAQELRRMGDEFNE	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
1386	MYP_025572	XXXSXNLXPA	NOT STANDARD	GnRH antagonist Endocrine Anticancer	Homo sapiens [Animal]; synthetic construct [Synthetic]	YES
1387	MYP_025586	GIMSSLMKKLAAHIAK	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Antifungal Hemolytic	Solitary wild [Animal]	NO
1388	MYP_025588	MVTVLFRRLRIRRACGPPRVRV	STANDARD	Cell-penetrating peptide Cargo delivery	not reported [other]	NO
1389	MYP_025594	GKMKEYFKKFGASFKRRFANLKKRL	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Lachesana tarabaevi [Animal]	YES
1390	MYP_025621	AGQTLTASGD	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
1391	MYP_025682	IKARASP	STANDARD	Anticancer	not reported [other]	NO
1392	MYP_025697	DWWPLXFEALLX	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
1393	MYP_025701	LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
1394	MYP_025729	MRPEIWFAQELRRIGDEFNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
1395	MYP_025764	KRRQRRR	STANDARD	Antimicrobial Anticancer	Protein derived [Animal]	NO
1396	MYP_025766	YTDFHCQYVK	STANDARD	Anticancer	Homo sapiens [Animal]	YES
1397	MYP_025784	LYPEFIASI	STANDARD	Anticancer	Homo sapiens [Animal]	YES
1398	MYP_025805	ERLRKRPDFLRVGFTATKKIGGAVERNRAKRRLREPLHDYVFLLDDVKTAL	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
1399	MYP_025817	ALSPVPPVV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
1400	MYP_025842	KKIWQKIKNFFQKL	STANDARD	Antimicrobial Antibacterial Antifungal	synthetic construct [Synthetic]	YES