FUNCTION: REGULATORY PEPTIDE

Found 4,634 peptides

Current Node: Regulatory peptide | Page 7 of 232

Level 2 Subcategories

Biological regulation (2953) Biological modulation (1391) Cell-cell communication (1015) Cell signaling / Growth factor signaling (235) Stimulation activity (92) Chemical communication (67) Activation activity (48) Receptor signaling modulation (4)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
121	MYP_003812	KSVRGKGKGQKRKRKKSRYKPWSV	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
122	MYP_003848	DINGKLFLPKYALSQDICTYRDFMYKTVEIPGCPPHVPPYFSYP	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
123	MYP_003856	LNKSDPAFIKGEQDRKKWCRLNLGPAWGGRTC	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
124	MYP_003877	QNSAAAFGAWM	STANDARD	Cell-Cell Communication Quorum Sensing	not reported [other]	YES
125	MYP_003906	YGGFLRKFGP	STANDARD	Metabolic	not reported [other]	NO
126	MYP_003931	GRRDFPEEVTIVEELRRRHADV	STANDARD	Metabolic	not reported [other]	NO
127	MYP_003976	CKKYKIWMHVDAAWGGGLL	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
128	MYP_004060	GSYYY	STANDARD	Neuropeptide	not reported [other]	YES
129	MYP_004140	LNKKSKKISRNEAEKKKRPSK	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
130	MYP_004143	ARDESSSFY	STANDARD	Neuropeptide Feeding Circuit Activator	Charonia tritonis [Animal]	NO
131	MYP_004168	QVVAECCYQSCTLDTLKSYCAD	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
132	MYP_004206	FYTPKTRRE	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
133	MYP_004211	AAAQHLCGSHLVDALYLVCGEKGFFYNPK	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation	Oncorhynchus gorbuscha [Animal]	YES
134	MYP_004281	MVPSAGQLALFALGIVLAACQALENSTSPLS	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
135	MYP_004295	GYRTCNTYF	STANDARD	Cell-Cell Communication Quorum Sensing	not reported [other]	YES
136	MYP_004363	SGPLRGEAEELPFQQEEYEKV	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
137	MYP_004365	WSKMDRLAKELTAE	STANDARD	Secretory granule peptide Neuropeptide precursor	Sus scrofa [Animal]	NO
138	MYP_004369	ANMDISTGHMILAYME	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
139	MYP_004395	RSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVN	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Molting regulator	Faxonius limosus [Animal]	YES
140	MYP_004529	YSTCDFICHXAXCXH	NOT STANDARD	Cell-Cell Communication Quorum Sensing	not reported [other]	YES