FUNCTION: ANTICANCER

Found 13,621 peptides

Current Node: Anticancer | Page 678 of 682

Level 2 Subcategories

Cytotoxic anticancer activity (8360) Tumor Homing Peptide (659) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (27) tumor necrosis factor family (19) Anti-breast cancer (9) Prostate cancer targeting (2) Anti-angiogenic activity (1) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
13541	MYP_173156	SYEKKINRHFKILKKNLKKK	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Ctenopharyngodon idella [Animal]	YES
13542	MYP_173178	XLIVAGK	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	YES
13543	MYP_173208	TYNPDFSSL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
13544	MYP_173219	GYCFTACARRNGARICYRRCN	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
13545	MYP_173220	TSFSEYWSLLS	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
13546	MYP_173228	KKLLKFKKLQ	STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
13547	MYP_173232	LSQETFNNLWKLLNQN	STANDARD	Anticancer Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
13548	MYP_173246	MRPEIWFAQEFDRAGDEFNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
13549	MYP_173247	GLFAVIHKVASVIGGL	STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
13550	MYP_173274	ATPATPTVAQFVIQGSTICLVC	STANDARD	Antimicrobial Antibacterial Anticancer Antitumor Anti-Gram-positive	Streptomyces sp. OH-4156 [Bacterium]	YES
13551	MYP_173290	FHIVALLA	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
13552	MYP_173299	MRPEIWAAQELRRFGDEVNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
13553	MYP_173330	SSKYQ	STANDARD	Anticancer Prostate cancer targeting	synthetic construct [Synthetic]	YES
13554	MYP_173336	GCLEVDYFCGIPFVNNGLCCSGNCVFVCTPQ	STANDARD	Toxic Cytotoxic	not reported [other]	YES
13555	MYP_173351	GCCADPRCRYRCR	STANDARD	Toxic Cytotoxic	not reported [other]	YES
13556	MYP_173388	CVQCNGRCAL	STANDARD	Anticancer	not reported [other]	NO
13557	MYP_173389	KLWKKGKGGKLTKSLTWVLVGILV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
13558	MYP_173397	CPQVCQIVVKSVHDELQPYLRTLPVTARIDARAGIDYSLVAPPTATAQSLDVDLKVRGCPGKA	STANDARD	Antibiotic Antimicrobial Anti-Gram-negative Cytotoxic Non-hemolytic Non-ribosomal	Strix occidentalis caurina [Animal]	NO
13559	MYP_173398	KSCCKDTLARNCYNTCHFAGGSRPVCAGACRCKIISGPKCPSDYPK	STANDARD	Toxin Cytotoxic Antimicrobial	Hordeum vulgare [Plant]	YES
13560	MYP_173402	VALTGLTVAEYFR	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Sarconesiopsis magellanica [Animal]	YES