FUNCTION: ANTICANCER

Found 13,621 peptides

Current Node: Anticancer | Page 676 of 682

Level 2 Subcategories

Cytotoxic anticancer activity (8360) Tumor Homing Peptide (659) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (27) tumor necrosis factor family (19) Anti-breast cancer (9) Prostate cancer targeting (2) Anti-angiogenic activity (1) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
13501	MYP_172607	VIGGDICNINEHNFLVALYE	STANDARD	Toxic Cytotoxic	not reported [other]	NO
13502	MYP_172639	GIIKKIIKKIIKK	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
13503	MYP_172659	DIIKKVASVVG	STANDARD	Antimicrobial	not reported [other]	YES
13504	MYP_172666	DGCSNAGAFCGIHPGLCCSEICIVWCT	STANDARD	Toxic Cytotoxic	not reported [other]	YES
13505	MYP_172692	GLSDGEWQ	STANDARD	Antihypertensive	synthetic construct [Synthetic]	NO
13506	MYP_172700	CPLCNGRCAR	STANDARD	Anticancer	not reported [other]	NO
13507	MYP_172706	KPLLKKLLKKL	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
13508	MYP_172715	ALCLLLHLL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
13509	MYP_172721	WXVXL	NOT STANDARD	Antimicrobial Antibacterial Anticancer Anti-Gram-positive	not reported [other]	YES
13510	MYP_172725	FMEIET	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
13511	MYP_172741	RIKIGLFDQLSKL	STANDARD	Toxic Cytotoxic	not reported [other]	NO
13512	MYP_172774	GIMSSLMKKLAAHAAK	STANDARD	Antimicrobial Anticancer Cytotoxic	AMP [other]	YES
13513	MYP_172801	GIMDTVKNAAKNLAGQLLDKLK	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
13514	MYP_172805	SLWENFK	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Antifungal Anti-Gram-negative	not reported [other]	NO
13515	MYP_172808	PLFDKRQRCCNGRRGCSSRWCRDHSRCCGRR	STANDARD	Toxic Cytotoxic	not reported [other]	NO
13516	MYP_172831	TLDENPGVRY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
13517	MYP_172845	GLFSVVTGVLKAVGKNVAKNVGGSLLEQLKCKKISGGC	STANDARD	Antimicrobial Antifungal Antibacterial Anti-Gram-positive Anti-Gram-negative Hemolytic Anticancer	Rana dybowskii [Animal]	YES
13518	MYP_172853	HHHH	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
13519	MYP_172870	GMWSKLLGHL	STANDARD	Anticancer	not reported [other]	NO
13520	MYP_172876	RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	STANDARD	Antimicrobial Antibiotic Anti-Gram-negative Anti-Gram-positive Toxin Non-hemolytic	Stichodactyla helianthus [Animal]	YES