FUNCTION: REGULATORY PEPTIDE

Found 4,652 peptides

Current Node: Regulatory peptide | Page 67 of 233

Level 2 Subcategories

Biological regulation (2953) Biological modulation (1391) Cell-cell communication (1015) Stimulation activity (92) Activation activity (48) Cell signaling / Growth factor signaling (18) Chemical communication (0) Receptor signaling modulation (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
1321	MYP_049220	DVSASLAVLPDNFPRYPVGKFFQYDTWRQSTQRL	STANDARD	Neuropeptide	not reported [other]	NO
1322	MYP_049270	SPANAQITRKRHKINSFVGLM	STANDARD	Neuropeptide Neuromodulator Vasoactive Vasodilator Receptor modulation	Carassius auratus [Animal]	YES
1323	MYP_049308	QNWPRP	STANDARD	Cardiovascular Enzyme modulation Ion channel modulation ACE inhibitory	Bothrops jararaca [Animal]	YES
1324	MYP_049353	QLGLQDPPHMVADLSKKQGPWVEEEEAAYGWMDF	STANDARD	Hormone Gastrointestinal Neuropeptide	Bos taurus [Animal]	YES
1325	MYP_049358	MGQVFLLMPV	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
1326	MYP_049365	RSFN	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Molting regulator	Penaeus monodon [Animal]	YES
1327	MYP_049405	SPSAVPLIRFG	STANDARD	RFamide Neuropeptide Neuromodulator	Caenorhabditis elegans [Animal]	YES
1328	MYP_049409	LPHYNFGLG	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
1329	MYP_049584	HEVPSGPNPISN	STANDARD	Growth regulation Development regulation Receptor modulation ACE inhibitory	Arabidopsis thaliana [Plant]	YES
1330	MYP_049614	LKDLEEGIQALMRELEDRSPRGPQLLRPTYD	STANDARD	Metabolic	not reported [other]	NO
1331	MYP_049665	HAEPLFYLL	STANDARD	Antidiabetic	not reported [other]	NO
1332	MYP_049709	SDNFMRF	STANDARD	Neuropeptide Neuromodulator Myotropic Receptor modulation	Drosophila melanogaster [Animal]	YES
1333	MYP_049747	SVSEIQFMHNLGKHLSSVERVEWLRRKLQDVHNFVALGAPIAHRDGGSQRPRKKEDNVPAENHQKSLGEADKADVDVLIKAKSQ	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation Growth regulation Development regulation Receptor modulation ACE inhibitory	Felis catus [Animal]	NO
1334	MYP_049790	GIHVFILGCISAGLPKTEATW	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
1335	MYP_049850	AIFILAS	STANDARD	Pheromone	Enterococcus faecalis [Bacterium]; Streptococcus faecalis [Bacterium]	NO
1336	MYP_049865	SGSLSTFFLLFNRSFTQALGK	STANDARD	Cell-Cell Communication Quorum Sensing	not reported [other]	NO
1337	MYP_049895	SGPGPWQGGRRKFRRQRPRLSHKGPMPF	STANDARD	Hormone Endocrine Cardiovascular Growth regulation Development regulation Myotropic Receptor modulation Immunomodulatory	Bos taurus [Animal]	YES
1338	MYP_049920	AQEDTSSFY	STANDARD	Neuropeptide Feeding Circuit Activator	Charonia tritonis [Animal]	NO
1339	MYP_050034	QHP	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator	Homo sapiens [Animal]	NO
1340	MYP_050095	PTLQLETVENSANLARISSDSEMVRFLFYKQDTGLNLSTLVSVPYNNWFIST	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO