FUNCTION: ANTICANCER

Found 13,621 peptides

Current Node: Anticancer | Page 654 of 682

Level 2 Subcategories

Cytotoxic anticancer activity (8360) Tumor Homing Peptide (659) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (27) tumor necrosis factor family (19) Anti-breast cancer (9) Prostate cancer targeting (2) Anti-angiogenic activity (1) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
13061	MYP_167304	GIGAVLKVLTTGLPALISWIRKKRQQ	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
13062	MYP_167306	AFCNLRRCELSCRSLGLLGKCIGEECKCVPY	STANDARD	Toxin Venom Potassium channel inhibitor family Ion channel inhibitor Pathogenesis-associated Host defense	Mesobuthus tamulus [Animal]	YES
13063	MYP_167326	FLPIASLLGKYL	STANDARD	Antimicrobial	Lithobates catesbeiana [Animal]; Rana catesbeiana [Animal]	NO
13064	MYP_167327	WLLWIALRKK	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
13065	MYP_167360	RKKRRQRRR	STANDARD	Cell-penetrating peptide Cargo delivery	Human immunodeficiency virus 1 [Virus]	YES
13066	MYP_167361	FLQRIIGRLGRLF	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Antifungal	synthetic construct [Synthetic]	YES
13067	MYP_167366	LKLKKFKKLQ	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
13068	MYP_167413	YVSEKDVISAK	STANDARD	Anticancer	Homo sapiens [Animal]	NO
13069	MYP_167415	CCDLPCNAGCVPCC	STANDARD	Toxic Cytotoxic	not reported [other]	NO
13070	MYP_167418	RLGDGCTR	STANDARD	Anticancer	not reported [other]	NO
13071	MYP_167425	DNESQWFSYHLSFFNSV	STANDARD	Anticancer Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
13072	MYP_167436	HEHEHEHEHEHEHEHEHEHEGGGGGRRRRRRGDK	STANDARD	Cell-penetrating Drug delivery Tumor-targeting Tumor-penetrating	synthetic construct [Synthetic]	YES
13073	MYP_167439	YMDGTMSQV	STANDARD	Anticancer	Homo sapiens [Animal]	NO
13074	MYP_167460	YCQEFLWTCDEERKCCGDMVCRLWCKKRL	STANDARD	Toxic Cytotoxic	not reported [other]	NO
13075	MYP_167473	ANKRPVWIMAHMVNAVAQIDEFVNLGANSIETD	STANDARD	Toxic Cytotoxic	not reported [other]	NO
13076	MYP_167484	GXFKKTFHKVSHAVKSGIHAGQRGCSALGF	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
13077	MYP_167487	GIKRGIIKIIRRIKRI	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
13078	MYP_167489	RGGRLCYCRPRFCVCVGRG	STANDARD	Antimicrobial Antibacterial	not reported [other]	NO
13079	MYP_167491	RLIMRIYAPTTRRYG	STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
13080	MYP_167500	RPPGFTPFRKA	STANDARD	Cardiovascular Myotropic Enzyme modulation Ion channel modulation Receptor modulation ACE inhibitory	Megascolia flavifrons [Animal]	YES