FUNCTION: REGULATORY PEPTIDE

Found 4,652 peptides

Current Node: Regulatory peptide | Page 63 of 233

Level 2 Subcategories

Biological regulation (2953) Biological modulation (1391) Cell-cell communication (1015) Stimulation activity (92) Activation activity (48) Cell signaling / Growth factor signaling (18) Chemical communication (0) Receptor signaling modulation (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
1241	MYP_046209	SADPNFLRF	STANDARD	Neuropeptide Neuromodulator Myotropic	Panagrellus redivivus [Animal]	YES
1242	MYP_046247	SADPYRFMTVPT	STANDARD	Neuropeptide	not reported [other]	NO
1243	MYP_046282	SVCASYF	STANDARD	Antimicrobial	synthetic construct [Synthetic]	NO
1244	MYP_046283	GIVDQCCNNICTFNQLQNYCNVP	STANDARD	Hormone Metabolic	Octodon degus [Animal]	NO
1245	MYP_046386	QVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVLDEYISGVQTV	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Molting regulator	Faxonius limosus [Animal]	YES
1246	MYP_046397	LYENKPRRPYIL	STANDARD	Neuropeptide Hormone	Rattus norvegicus [Animal]	YES
1247	MYP_046415	QQPQGVHTYCGRHLARTLADLCWEAGVD	STANDARD	Hormone Endocrine Growth regulation Development regulation	Bombyx mori [Animal]	YES
1248	MYP_046481	SIKVAV	STANDARD	Immunomodulatory	synthetic construct [Synthetic]	NO
1249	MYP_046488	ISLMKRPPGFSPFR	STANDARD	Neuropeptide	not reported [other]	NO
1250	MYP_046499	SRVFIATHF	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
1251	MYP_046555	TATTRRRGRPPGFSPFR	STANDARD	Vasoactive Vasodilator Cardiovascular Myotropic Receptor modulation	Vespula maculifrons [Animal]	NO
1252	MYP_046560	DINGKLFLPKYALSQDVCTYGDFMYKTVEIPGCPRHVTPYFSYP	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
1253	MYP_046618	QPSFTHAFV	STANDARD	Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Myotropic Pruriceptive Feeding regulator	Aplysia californica [Animal]	NO
1254	MYP_046629	AEEENTGGLPGVQLSPCTSPPVGLIPCSAPWS	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Receptor modulation Feeding regulator	Mus musculus [Animal]	NO
1255	MYP_046630	HTRAAPSSGQLSLLSKAEDDEEPRSSLTELLARIISTKGTYRRSPSPKSKSMGNNHRIKDRDYLGWMDF	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Reproductive regulator Myotropic Feeding regulator	Carassius auratus [Animal]	NO
1256	MYP_046671	ASFQRNQLLQKEPDLRLENVQRFALTEMIYEENSRDNPF	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
1257	MYP_046681	GTCNTDSDECAHKASSGDGARCSKPLRHIYPYPGLNS	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
1258	MYP_046761	MMAAGPRTSLLLAFALLCLPWTQVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEF	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
1259	MYP_046766	AEIDFSGIPEDIIKQIKETNAKPPA	STANDARD	Anti-inflammatory Cardiovascular Enzyme modulation Ion channel modulation Receptor modulation ACE inhibitory	Tityus serrulatus [Animal]	NO
1260	MYP_046779	AATQHLCGSHLVEALYLVCGERGFFYSPKA	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO