FUNCTION: BINDING / MOLECULAR INTERACTION

Found 5,826 peptides

Current Node: Binding / Molecular interaction | Page 62 of 292

Level 2 Subcategories

Binding activity (5389) Protein-protein interaction (5000) Metal binding (64) Metal-binding peptide (59) Receptor/ligand interaction (32) Cell adhesion (27) Calcium binding (26) Surface glycoprotein binding (1) Carbohydrate-binding peptide (0) Metal-binding / iron acquisition (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
1221	MYP_036296	TSFQQYCDDNPDAAECRIYDD	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1222	MYP_036350	SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS	STANDARD	Cytokine Growth factor intercrine beta (chemokine CC) family Chemoattractant Chemokine-like Growth factor signaling Angiogenic Heparin-binding	Homo sapiens [Animal]	NO
1223	MYP_036357	YLVTSV	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1224	MYP_036398	NLDSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTR	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1225	MYP_036432	KARVLAEAM	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1226	MYP_036481	DHMEMEPETMETKSVTDYF	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1227	MYP_036491	SLLTEVETP	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1228	MYP_036598	QVPSDPYN	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1229	MYP_036621	SIKIRPRQAFYA	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1230	MYP_036660	ADRELEELLESALDDFD	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1231	MYP_036710	PDFEPIPL	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1232	MYP_036752	PAPELLG	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1233	MYP_036778	SGKSQTVIVGSWGAK	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1234	MYP_036800	VSKWRMATPLLMQAL	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1235	MYP_036831	LDEETGEFL	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1236	MYP_036838	TERHKILHRLLQEGSP	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1237	MYP_036862	EPQNCSAT	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1238	MYP_036871	HIGPGRAFYT	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1239	MYP_036874	PQLKPIEASILAARRV	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
1240	MYP_036875	YDQIL	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES