FUNCTION: REGULATORY PEPTIDE > BIOLOGICAL REGULATION

Found 2,953 peptides

Current Node: Biological regulation | Page 6 of 148

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
101	MYP_005601	AQEEAEAEERRLQEQEELENYIEHVLLRRP	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Growth regulation Development regulation Neuropeptide precursor Secretory granule peptide Cell-Cell Communication	Bos taurus [Animal] [Animal]; Tupaia belangeri [Animal]	NO
102	MYP_005636	GFADKCCAIGCSKEELAVACLPFVDF	STANDARD	Hormone Endocrine Reproductive regulator Growth regulation Development regulation	Rattus norvegicus [Animal]	YES
103	MYP_005641	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Growth regulation Development regulation Receptor modulation Feeding regulator	Homo sapiens [Animal]	YES
104	MYP_005679	SVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGAPIAHRDGSSQRPLKKEDNVLVESYQKSLGEADKADVDVLTKAKSQ	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation Receptor modulation ACE inhibitory	Canis lupus familiaris [Animal]	YES
105	MYP_005826	NYDSENRFDIPKLYPWRAENTELYEDDAQPTNGEEINGFYGKQRENM	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
106	MYP_005854	RLPSYGHSFL	STANDARD	Neuropeptide	not reported [other]	YES
107	MYP_006006	LLALWGPDPAAAFVNQ	STANDARD	Antidiabetic	not reported [other]	NO
108	MYP_006033	PLALEGSLQKRGIVEQC	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
109	MYP_006063	YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY	STANDARD	Antimicrobial Drug Delivery Vehicle Blood-Brain Barrier	not reported [other]	YES
110	MYP_006073	ALDTLGGFQVHGW	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Feeding regulator	Aplysia californica [Animal]	YES
111	MYP_006082	ISNPAATHQDIDFLI	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
112	MYP_006176	QPPLPRY	STANDARD	Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Myotropic Feeding regulator	Aplysia californica [Animal]	YES
113	MYP_006242	YPLDLF	STANDARD	Antihypertensive ACE inhibitory	not reported [other]	NO
114	MYP_006251	YPVLSSKVPGKPDYFLILLSTCPARLEGSDGLAFLKPILEKTSMKRSFRNGVGSGVKKTSFRRAKQ	STANDARD	Neuropeptide Neuromodulator Receptor modulation Immunomodulatory ACE inhibitory Sleep regulation Wake regulation	Rattus norvegicus [Animal]	YES
115	MYP_006284	LSGAQYQQHGRAL	STANDARD	Cell-Cell Communication	not reported [other]	YES
116	MYP_006340	GGPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
117	MYP_006451	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT	STANDARD	Hormone	Sus scrofa [Animal]; Homo sapiens [Animal]; Mus musculus [Animal]; Rattus norvegicus [Animal]; Bos taurus [Animal]; Oryctolagus cuniculus [Animal]; Camelus dromedarius [Animal]; Cavia porcellus [Animal]; Xenopus laevis [Animal]	NO
118	MYP_006488	SVRYITYPAIDRGDHAVHCDKAHPNTCKKKQANPYRRGCGVLEGCHRETGPKPT	STANDARD	Hormone Endocrine Growth regulation Development regulation Receptor modulation ACE inhibitory	Arabidopsis thaliana [Plant]	YES
119	MYP_006563	CLAGLVFVSEADPVSTDEDKCPLMVKVL	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
120	MYP_006582	MGKISSLPTQLFKCCFCDFLK	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO