FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 58 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
1141	MYP_021318	GWWRRTVAKVRNAGRK	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
1142	MYP_021324	VKVKVKCTKSGCKVKVKV	STANDARD	Anticancer Toxin-related activity Antifungal Antibacterial Antimicrobial	not reported [other]	NO
1143	MYP_021341	PRAWEYWLRL	STANDARD	Anticancer	not reported [other]	NO
1144	MYP_021346	GFQKAKAKALACLAKALA	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
1145	MYP_021400	DIDFSTCARMDVPILKKAAQGLCITSCSMQNCGTGSCKKRSGRPTCVCYRCANGGGDIPLGAL	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	Caenorhabditis elegans [Animal]	YES
1146	MYP_021405	LKPLLKPLLKPLLKPLLKPLLKPLLKPL	STANDARD	Antimicrobial Antibacterial Anti-Gram-negative	synthetic construct [Synthetic]	YES
1147	MYP_021406	GRKKRRQRRRPQAVPIAQK	STANDARD	Anticancer	not reported [other]	NO
1148	MYP_021427	AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL	STANDARD	Antimicrobial Antiviral Antifungal	Homo sapiens [Animal]	NO
1149	MYP_021442	KLKLPIIMK	STANDARD	Anticancer	Homo sapiens [Animal]	YES
1150	MYP_021443	GLHKVMREVLGY	STANDARD	Antimicrobial Antibacterial Antifungal	synthetic construct [Synthetic]	YES
1151	MYP_021448	LYSACFWWL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
1152	MYP_021451	RPFHTRATV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
1153	MYP_021462	MRPEIWAAQEIDRIGDEVNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
1154	MYP_021469	NVVRQ	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
1155	MYP_021535	MRLLALSGLLCMLLLCFCIFSSEGRRHPAKSLKLRRCCHLSPRSKLTTWKGNHTRPCRLCRNKLPVKSWVVPGALPQI	STANDARD	Antimicrobial Antibiotic Anti-Gram-negative Anti-Gram-positive Cytokine Anticancer Chemotactic Non-hemolytic	Mus musculus [Animal]	NO
1156	MYP_021542	FAKLLAKALKKAL	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
1157	MYP_021575	DXXPLAXEALXR	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
1158	MYP_021591	XACRDRFRRCPADRRLCG	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
1159	MYP_021678	FLSLIPKAIKAVSALAKKL	STANDARD	Antimicrobial Antifungal Anticancer	synthetic construct [Synthetic]	YES
1160	MYP_021682	YSWMDISCWI	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO