FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 51 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
1001	MYP_018794	IYLATALAKWALKQGGRRRRRRR	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
1002	MYP_018805	MRPEIWIAQELDRIGDEFNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
1003	MYP_018852	GVIPCGESCVFIPCISTLLGCSCKNKVCYRN	STANDARD	Antimicrobial Antibacterial Antifungal Hemolytic Cytotoxic Antiviral Insecticidal Anti-HIV Anti-Gram-positive	Chassalia parvifolia [Plant]	YES
1004	MYP_018860	GMPPCLLAL	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	YES
1005	MYP_018881	VGFGKAL	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
1006	MYP_018891	VTCDLLSFEILGVALNHSACAAHCLAIGRGGGACQGGICVCRR	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
1007	MYP_018894	KRKILILIKRK	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
1008	MYP_018906	WYANXEKLXR	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
1009	MYP_018907	GAVPCGETCVYLPCITAAIGCSCQNKVCYRD	STANDARD	Antimicrobial Anticancer	Hedyotis biflora [Animal]	NO
1010	MYP_018950	ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS	STANDARD	Antimicrobial Antibacterial Antifungal	Oryctes rhinoceros [Animal]	NO
1011	MYP_018972	SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDN	STANDARD	Anticancer Cytotoxic Enzyme inhibitory ACE inhibitory Antihypertensive	Glycine max [Plant]	NO
1012	MYP_019064	GFLGILFHGVHHGRKKALHMNSERRS	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	Halibut [Animal]	YES
1013	MYP_019084	MRPEIWFAQELDRFGDEFNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
1014	MYP_019086	MRPEIWFAQEIDRAGDENNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
1015	MYP_019094	RKKARQRRR	STANDARD	Cell-penetrating peptide Cargo delivery	Human immunodeficiency virus 1 [Virus]	NO
1016	MYP_019097	XEEEEERQIKIWFQNRRKWKK	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
1017	MYP_019099	RPFIRAQWFAIQHISPRTIAMRAINNYRWR	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	YES
1018	MYP_019100	GIMSSLMKKLAAAIAK	STANDARD	Antimicrobial Anticancer Cytotoxic	AMP [other]	YES
1019	MYP_019108	GLPVCGETCF	STANDARD	Anticancer	not reported [other]	NO
1020	MYP_019145	CGEGHPC	STANDARD	Anticancer	not reported [other]	NO