FUNCTION: METABOLIC > APPETITE AND FEEDING REGULATION

Found 287 peptides

Current Node: Appetite and feeding regulation | Page 5 of 15

Level 3 Subcategories

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
81	MYP_046803	APVTAGRGGALAKMYTRGNHWAVGHLM	STANDARD	Cell-Cell Communication	not reported [other]	YES
82	MYP_049146	WYKHVASPRYHTVGRASGLLMGL	STANDARD	Neuropeptide	Rattus norvegicus [Animal]	NO
83	MYP_050034	QHP	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Feeding regulator	Rattus norvegicus [Animal]	YES
84	MYP_050520	TDECELCINVACTGC	STANDARD	Receptor modulation	Notomys alexis [Animal]	NO
85	MYP_050922	WCLESSQCQDLTTESNLLACIRACRLDLSAETPVFPGNGDEQPLTENPRKYVMGHFRWDRFGPRNSSSAGGSAQ	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Cardiovascular Metabolic regulation Physiological regulation Receptor modulation Feeding regulator	Rattus norvegicus [Animal]	NO
86	MYP_051095	GSPGFSHSFV	STANDARD	Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Myotropic Pruriceptive Feeding regulator	Aplysia californica [Animal]	YES
87	MYP_051232	SLDSLGSFQVHGW	STANDARD	Behavior Regulator	Aplysia californica [Animal]	NO
88	MYP_051265	YPVKPENPGDDAPAEELAKYYSALRHYINLITRQRY	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Reproductive regulator Feeding regulator	Paralichthys olivaceus [Animal]	YES
89	MYP_051561	TLCSEKLNEVLSMVCEEYNPVIPH	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation Reproductive regulator Growth regulation Development regulation Receptor modulation Sleep regulation Wake regulation Feeding regulator	Drosophila melanogaster [Animal]	YES
90	MYP_052592	SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation Growth regulation Development regulation Feeding regulator	Mus musculus [Animal]	NO
91	MYP_053209	AIPSYSHNFV	STANDARD	Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Myotropic Pruriceptive Feeding regulator	Aplysia californica [Animal]	YES
92	MYP_053379	QEDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQIEALQEVLKKLKS	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Cardiovascular Metabolic regulation Physiological regulation Growth regulation Development regulation Receptor modulation ACE inhibitory Feeding regulator	Rattus norvegicus [Animal]	YES
93	MYP_053752	LENPSPQAPARRLLPP	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Feeding regulator	Mus musculus [Animal]	YES
94	MYP_055462	QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Cardiovascular Metabolic regulation Physiological regulation Growth regulation Development regulation Receptor modulation ACE inhibitory Feeding regulator	Homo sapiens [Animal]	YES
95	MYP_056225	GSSFLSPEHQRVQQRKESKKPPAKLQP	STANDARD	Cell-Cell Communication	not reported [other]	YES
96	MYP_056525	KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation Growth regulation Development regulation Immunomodulatory Feeding regulator	Homo sapiens [Animal]	NO
97	MYP_058385	HSDGMFTSELSRLQDSARLQRLLQGLV	STANDARD	Neuropeptide	not reported [other]	YES
98	MYP_059733	SSPETLISDLLMRESTGNIPRTRLEDPSMW	STANDARD	NPY-family Neuropeptide Neuromodulator	Bos taurus [Animal]	NO
99	MYP_060241	FRVDEEFQSPFASQSRGYFLFRPRN	STANDARD	Neuropeptide Hormone	Homo sapiens [Animal]	NO
100	MYP_060571	GKKPSGPNPGGNN	STANDARD	Metabolic regulation Physiological regulation Growth regulation Development regulation Feeding regulator	Meloidogyne arenaria [Animal]	NO