FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 49 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
961	MYP_018052	YIHYIF	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
962	MYP_018083	VLEPPGARDV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
963	MYP_018089	GLFGKLQKKFGRKAISYAVKKARGKH	STANDARD	Hemolytic	synthetic construct [Synthetic]	YES
964	MYP_018091	QLMAFNHLI	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
965	MYP_018107	GIMSALMKALAAHIAK	STANDARD	Cytotoxicity	synthetic construct [Synthetic]	YES
966	MYP_018117	GFKLKGMARISCLPNGQWSNFPPKCIRECAMVSS	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
967	MYP_018162	RKWWK	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
968	MYP_018170	VTXXXWAVVF	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
969	MYP_018174	GIGAVLKVLTTGLPALKSWIKRKRQQ	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
970	MYP_018184	WYANFEKLLR	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
971	MYP_018198	FLPIVAKLLSKLL	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
972	MYP_018201	KLLKLFKKKQ	STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
973	MYP_018224	ADPRVKKVLGVAMQIRKAQLMREKLNSIMRR	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
974	MYP_018233	FLPIIAKVLSGLL	STANDARD	Antimicrobial Antifungal	Rana boylii [Animal]	YES
975	MYP_018250	PLILLRLLRGQF	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
976	MYP_018251	GIIKKI	STANDARD	Antimicrobial Anticancer Hemolytic	not reported [other]	NO
977	MYP_018253	FRKSKEKIGKEFKRIVQRIKDFLRNLV	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
978	MYP_018263	GIMASLMKKLAAHIAK	STANDARD	Antimicrobial Anticancer	AMP [other]	YES
979	MYP_018289	YMNGTMSQV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
980	MYP_018294	QLIKKLRTWYRKAWHVLGKL	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES