FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 470 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
9381	MYP_173458	KDLLLHLKKLFREGQFN	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
9382	MYP_173471	CYTADPC	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
9383	MYP_173489	LEDVTGEEF	STANDARD	Antimicrobial Anticancer	not reported [other]	NO
9384	MYP_173493	KIAGLAANFLPQILCKIARKC	STANDARD	Hemolytic	synthetic construct [Synthetic]	YES
9385	MYP_173511	FFPGIIKVASAILPTAICAITKRC	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	NO
9386	MYP_173554	TDSILRSYDWTY	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
9387	MYP_173558	FIITGLVRGLTKLF	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Hemolytic Cytolytic Anticancer Anti-Gram-negative	not reported [other]	NO
9388	MYP_173581	VDKPPYLPRPRWYRRIYNR	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
9389	MYP_173583	RQIKIW	STANDARD	Cell-penetrating peptide	Drosophila melanogaster [Animal]	YES
9390	MYP_173611	MIISRDLISH	STANDARD	Cell-penetrating peptide Cargo delivery	Homo sapiens [Animal]	YES
9391	MYP_173645	YLAEADLSYT	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
9392	MYP_173650	ILGKLLSWAAGLLSNL	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
9393	MYP_173652	CKGRGKRCREKQRPSDKPRR	STANDARD	Anti-angiogenic	Homo sapiens [Animal]	NO
9394	MYP_173665	EIRLPEPFRFPSPTVPKPIDIDPILPHPWSPRQTYPIIARRS	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Antifungal Anti-Candida Anti-Yeast Anti-Gram-negative Non-hemolytic Anticancer	not reported [other]	NO
9395	MYP_173699	FLKLDRERA	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
9396	MYP_173726	FLPLIGRVLSGIL	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Rana temporaria [Animal]	YES
9397	MYP_173746	KCFWKTCT	STANDARD	Anticancer Targeting	Bombina bombina [Animal]	YES
9398	MYP_173758	LYPLHTYTPLSLPLF	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
9399	MYP_173766	DFKLFAVYIKYR	STANDARD	Anti-angiogenic Antimicrobial Anticancer Cytotoxic Hemolytic	not reported [other]	NO
9400	MYP_173777	EDCTSRFCS	STANDARD	Anticancer	not reported [other]	NO