FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 462 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
9221	MYP_170814	LVTSAGKGNSSPKKIDCGGACAARCQLSSRPHLCKRACGTCCARCACVPPGTAGNQEMCPKCYASLTTHGGKRKCP	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
9222	MYP_170816	CYKYY	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
9223	MYP_170827	GIGAVLKWLPALIKRKRQQ	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
9224	MYP_170846	DLMAQMQGPYNFIQSMLDFENQTL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
9225	MYP_170849	TAXYANXEKLLR	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	YES
9226	MYP_170875	ANTAFVSSAHNTQKIPAGAPFNRNLRAMLADLRQNAAFAG	STANDARD	Antimicrobial Antifungal Antiviral Anti-HIV Anti-Gram-negative Anti-Gram-positive Lectin Non-hemolytic	Ginkgo biloba [other]	YES
9227	MYP_170887	PICKRNGLPVCGETCTLGTCYTQGCTCSW	STANDARD	Toxic Antimicrobial Hemolytic Uteroactive	not reported [other]	YES
9228	MYP_170894	VLAVSVLAA	STANDARD	Anticancer	Homo sapiens [Animal]	NO
9229	MYP_170914	LKXLKKLXKLLXLL	NOT STANDARD	Anticancer	not reported [other]	YES
9230	MYP_170917	KAMSWYA	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
9231	MYP_170925	GLFDIVKKIAGHIA	STANDARD	Anticancer	not reported [other]	NO
9232	MYP_170932	AIMSSLMKKLAAHIAK	STANDARD	Antimicrobial Anticancer	AMP [other]	YES
9233	MYP_170957	YVSEVPVSV	STANDARD	Anticancer	Homo sapiens [Animal]	NO
9234	MYP_170971	HRIKRSDEFSRVLSVSKKIGNAVTRNRVKRLIRTISDYVIVKGSL	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
9235	MYP_171043	GIIKKIIKKIIKKK	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
9236	MYP_171068	ETFSDLWKLL	STANDARD	Anticancer	not reported [other]	YES
9237	MYP_171079	RWPSCQKKF	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
9238	MYP_171087	GCNGRC	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
9239	MYP_171092	KVVKKVKKKVKKVVK	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
9240	MYP_171184	LWGRFFRKWK	STANDARD	Antimicrobial Wound healing Anticancer	synthetic construct [Synthetic]	YES