FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 459 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
9161	MYP_169502	LLGDFKRIVQRIKDF	STANDARD	Anticancer Antibacterial Antimicrobial	not reported [other]	YES
9162	MYP_169608	NRWWQGVVPTVSYECRMNSWQHVFF	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
9163	MYP_169650	FAKLLAKLAKKSL	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
9164	MYP_169659	HTLLTPRR	STANDARD	Anticancer	not reported [other]	NO
9165	MYP_169666	WELVVLYGRKKRRQRRR	STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
9166	MYP_169670	LAANFLPQILCKIARKC	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
9167	MYP_169709	RIRWRIRIL	STANDARD	Anticancer Toxin-related activity Antifungal Antibacterial Antimicrobial	not reported [other]	NO
9168	MYP_169736	MKIAFIVAISLAFLAVTSCIEFEKSTESHDIQKRGVTITVKPPFPGCVFYECIANCRSRGYKNGGYCTIN	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
9169	MYP_169801	FALALKLAKK	STANDARD	Anticancer	not reported [other]	NO
9170	MYP_169816	KRIRFFERIRDRLRDLGNRIKNRIRDFFS	STANDARD	Antimicrobial Antifungal	Sarcophilus harrisii [Animal]	YES
9171	MYP_169830	RVKLVNLXFATLREXVP	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
9172	MYP_169844	YRPWGSGSGF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
9173	MYP_169864	GVITDTLKGVAKTVAAELLRKAHCKLTNSC	STANDARD	Antimicrobial Antifungal Anti-inflammatory	Microhyla pulchra [Animal]	YES
9174	MYP_169926	QLGRRRHRRRPSRRRRHW	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
9175	MYP_169967	FPYPGMTNQ	STANDARD	Anticancer	Homo sapiens [Animal]	NO
9176	MYP_169973	GFPCGESCVYIPCFTAAIGCSCKSKVCYKN	STANDARD	Antimicrobial Anticancer	medicinal herb Hybanthus enneaspermus [Plant]	YES
9177	MYP_169985	RQLEVPWPYI	STANDARD	Anticancer	Homo sapiens [Animal]	NO
9178	MYP_169990	KETWFETWFTEWSQPKKKRKV	STANDARD	Drug Delivery Vehicle Cell-penetrating peptide	not reported [other]	YES
9179	MYP_170015	GKCIAKAILKGAKKLLKKLVNP	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
9180	MYP_170023	KTCPVQLWV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO