FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 452 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
9021	MYP_167070	CTLEW	STANDARD	Antimicrobial Anticancer	walnut residual protein [other]	YES
9022	MYP_167071	TSPTNRS	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
9023	MYP_167080	FAKLLAKALKKFL	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
9024	MYP_167081	GLFDIVKKIAGHIASSI	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anticancer	Litoria aurea [Animal]	YES
9025	MYP_167116	RLAEYQAYI	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
9026	MYP_167137	MEIFIEVFSHF	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
9027	MYP_167164	ANTPCGPYTHDCPVKR	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
9028	MYP_167182	KFAKFAKKFAKFAKGGQQFFGLM	STANDARD	Antibacterial Anti-Gram-positive Anticancer Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
9029	MYP_167197	QIKIWFQNRRMKWKK	STANDARD	Cell-penetrating peptide	Drosophila melanogaster [Animal]	YES
9030	MYP_167207	CLVVHEAAC	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
9031	MYP_167258	NVDPVQHTY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
9032	MYP_167267	MRPEIWFAQEIDRIGDENNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
9033	MYP_167269	QVHPQKVT	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
9034	MYP_167281	XRRRRKRRRE	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
9035	MYP_167291	LLDVAPLSL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
9036	MYP_167297	MNFTRIIFFLFVVVFATASGKPWNIFKEIERAVARTRDAVISAGPAVATVAAATSVASG	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
9037	MYP_167304	GIGAVLKVLTTGLPALISWIRKKRQQ	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
9038	MYP_167326	FLPIASLLGKYL	STANDARD	Amphibian defense peptide Antibiotic Antimicrobial Hemolytic Non-ribosomal	Lithobates catesbeianus [Animal]	NO
9039	MYP_167360	RKKRRQRRR	STANDARD	Cell-penetrating peptide Cargo delivery	Human immunodeficiency virus 1 [Virus]	NO
9040	MYP_167366	LKLKKFKKLQ	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	YES