FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 446 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
8901	MYP_164500	QRTESIIHRALYYDLIS	STANDARD	Anti-angiogenic	Homo sapiens [Animal]	YES
8902	MYP_164505	TLTVLPW	STANDARD	Anticancer	not reported [other]	NO
8903	MYP_164543	SKLGRFTFCSC	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
8904	MYP_164544	GFGMALXLLXXVL	NOT STANDARD	Antimicrobial Antibacterial Antifungal	synthetic construct [Synthetic]	YES
8905	MYP_164582	GLFKIISKLAKKA	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
8906	MYP_164611	SLFKDQMEL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8907	MYP_164642	WTGWCLNPEESTWGFCTGSF	STANDARD	Anticancer Targeting	synthetic construct [Synthetic]	YES
8908	MYP_164644	XLXPPX	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	YES
8909	MYP_164653	DLFKQLQRLFLGILYCLYKIW	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
8910	MYP_164663	HGYTSHGAHGV	STANDARD	Immunomodulatory Antiviral Antitumor	synthetic construct [Synthetic]	YES
8911	MYP_164687	ANDPIFVVL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8912	MYP_164725	LLGPVLGLVSNALGGLLKNI	STANDARD	Antimicrobial Antibacterial Antifungal	Bombina maxima [Animal]	YES
8913	MYP_164735	LYATVIHDI	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8914	MYP_164736	AHPKVKRKLKRMQRKKDGKQKRH	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
8915	MYP_164763	KWKLFKKILKFLHLAKKF	STANDARD	Anticancer Cytotoxic	Hyalophora cecropia [Animal]	YES
8916	MYP_164811	FDIVKKIAGHIAGSIG	STANDARD	Antimicrobial Antibacterial Anticancer	Litoria aurea; Litoria raniformis [Animal]	YES
8917	MYP_164834	GWWRRTAAKVRK	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
8918	MYP_164846	WVILSKKIKRKKKENSDHQTKFSKKVKTKR	STANDARD	Antimicrobial Anticancer	Pardosa astrigera [Animal]	YES
8919	MYP_164847	GLLSVLGSVAKHVLPH	STANDARD	Antimicrobial Antibacterial Antifungal Anticancer nNOS inhibitor	Litoria gilleni [Animal]	YES
8920	MYP_164867	PLQPEQLQV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO