FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 444 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
8861	MYP_163705	AGCIKNGGRCNASAGPPYCCSSYCFQIAGQSYGVCKNR	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Antifungal	Phytolacca americana [Animal]	YES
8862	MYP_163749	KSCCPTTTARNIYNTCRFGGGSRPICAKLSGCKIISGTKCD	STANDARD	Anticancer Cytotoxic Toxin	Phoradendron tomentosum [Plant]	YES
8863	MYP_163777	FFRLLFHGVHHGGGYLNAA	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Pseudopleuronectes americanus [Animal]	YES
8864	MYP_163780	YF	STANDARD	Antidiabetic DPP-IV inhibitory	synthetic construct [Synthetic]	YES
8865	MYP_163792	GAVPCGETCVYLPCITPDIGCSCQNKVCYRD	STANDARD	Antimicrobial Anticancer	Hedyotis diffusa [Animal]	YES
8866	MYP_163808	QILKGLLFL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8867	MYP_163821	RIIRWWWRIIR	STANDARD	Anticancer Toxin-related activity Antibacterial Antimicrobial	not reported [other]	NO
8868	MYP_163855	YARAAARQARA	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	NO
8869	MYP_163869	KKLALHALKKWLHALKKLAHLALKK	STANDARD	Antimicrobial Antibacterial Anti-Gram-negative Antiplasmodial	Synthetic construct [Synthetic]	YES
8870	MYP_163912	DWWPXAFEXLLR	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
8871	MYP_163928	GFGCPNDYPCHRHCKSIPGRAGGYCGGAHRLRCTCYR	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Mytilus edulis [Animal]	YES
8872	MYP_163947	HLQIQPWYPQIS	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
8873	MYP_163949	GLFKVLGSIAKHLLPHVVPVVAEK	STANDARD	Antimicrobial Antibacterial	not reported [other]	NO
8874	MYP_163954	FALALKA	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
8875	MYP_163959	VIYFMGAIF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8876	MYP_163970	TKPR	STANDARD	Antimicrobial Drug delivery	Homo sapiens [Animal]	NO
8877	MYP_163975	ERLRGSCRVRRFLATFRRGYGKAVARNRARRLSKELVDLVLLLCVL	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
8878	MYP_163986	IRIILRAQGALKI	STANDARD	Antimicrobial	Oryzias latipes [Animal]	YES
8879	MYP_163989	VSRFKSFFRKLKKLV	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
8880	MYP_163995	KWKSFLKTFKSLKKTVLHTLLXAISS	NOT STANDARD	Anticancer Toxic Hemolytic	not reported [other]	NO