FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 440 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
8781	MYP_162109	LRAAFFGKCF	STANDARD	Anticancer	Homo sapiens [Animal]	NO
8782	MYP_162120	GKCIAKAIFKGAKKLLKKLVNP	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
8783	MYP_162123	MSSRRSSSCKYCEQDFRAHTQKNAATPFLAN	STANDARD	Apoptosis Regulator	Mus Musculus [Animal]; Homo sapiens [Animal]	NO
8784	MYP_162124	GCRRLCYKQRCVTWCRGR	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
8785	MYP_162165	LIIFRILISHR	STANDARD	Antimicrobial Anticancer Cytotoxic	Protein derived [Animal]	YES
8786	MYP_162201	KAAKKAWKAWKKAAKAAWKKAA	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
8787	MYP_162205	RCLPAGKTCVRGPMRVPCCGSCSQNKCT	STANDARD	Antimicrobial Antimalarial Antiparasitic	not reported [other]	YES
8788	MYP_162235	NGRKISLDLRAPLYKKIIKKLLES	STANDARD	Anti-angiogenic	Homo sapiens [Animal]	YES
8789	MYP_162265	LLDPRSYHTY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8790	MYP_162277	RYEGILYTI	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8791	MYP_162284	YLSNIIPAL	STANDARD	Anticancer	Homo sapiens [Animal]	NO
8792	MYP_162291	KIAKVALAKLGIGAVLKVLTTGL	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
8793	MYP_162293	NPFTIFP	STANDARD	Anticancer Antibacterial Antimicrobial	not reported [other]	NO
8794	MYP_162327	QYSWFVNGTF	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8795	MYP_162346	AKKRAKKRAHQQ	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Antibiofilm Biofilm inhibition Antifungal	not reported [other]	NO
8796	MYP_162392	GYCFTACYLRNGVRICYRRCN	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
8797	MYP_162409	GQTKGRYYVPCFFNAITCYR	STANDARD	Hormone	Pedetontus okajimae [Animal]	NO
8798	MYP_162413	YRGGYTGPIPRPPPIGRPPFRPVCNACYRLSVSDARNCCIKFGSCCHLVK	STANDARD	Antimicrobial Antifungal Anticancer	Penaeus vannamei [Animal]	YES
8799	MYP_162419	DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL	STANDARD	Hormone Metabolic	Rattus norvegicus [Animal]	NO
8800	MYP_162438	WPLAXEALXR	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	YES