FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 437 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
8721	MYP_161079	FRRPFKWFRRFFKFF	STANDARD	Antimicrobial Antibacterial Antifungal	synthetic construct [Synthetic]	YES
8722	MYP_161118	CSKCNGRCGH	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
8723	MYP_161119	GWTLNSAGYLLGXINLKALAALAKKIL	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
8724	MYP_161131	TVPFA	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
8725	MYP_161201	RLKRWWKFL	STANDARD	Antimicrobial Antibacterial Antifungal	synthetic construct [Synthetic]	YES
8726	MYP_161203	GWLRDFGKRIERTGQNIRDATIQTIGIAQEAANVAATLK	STANDARD	Antimicrobial Antibacterial Antifungal	synthetic construct [Synthetic]	YES
8727	MYP_161209	EPAGIGILTV	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
8728	MYP_161230	GTELLSLVY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8729	MYP_161253	FLALIICNA	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8730	MYP_161256	NRFTARFRRTPWRLCLQFRQ	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
8731	MYP_161257	AYRPSETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE	STANDARD	Anticancer Cytotoxic Hormone Endocrine Cardiovascular Metabolic regulation Physiological regulation Reproductive regulator Growth regulation Development regulation Receptor modulation ACE inhibitory	Rattus norvegicus [Animal]	YES
8732	MYP_161262	FSDMRL	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
8733	MYP_161281	MIIFRDLISH	STANDARD	Cell-penetrating peptide Cargo delivery	Homo sapiens [Animal]	YES
8734	MYP_161290	LTVSPWYGCGMPFSTGKRIMLGE	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
8735	MYP_161303	TVPWPFPL	STANDARD	Toxin	Stylotella aurantium [Animal]	NO
8736	MYP_161320	RRQRRTSKLMKRGGKLAKLAKKLAKLAK	STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
8737	MYP_161399	VYSDADIFL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8738	MYP_161426	VLPALLLVL	STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
8739	MYP_161469	HCQRPA	STANDARD	Anticancer Cytotoxic Immunomodulatory	Glycine max [Plant]	YES
8740	MYP_161488	KTCEHLADTY	STANDARD	Antimicrobial Antifungal Anticancer Cytotoxic Antiviral Anti-HIV	Pisum sativum [Plant]	YES