FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 434 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
8661	MYP_160033	RFRLPFRRPPIRIH	STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
8662	MYP_160057	RWKIFKKIER	STANDARD	Anticancer	not reported [other]	NO
8663	MYP_160083	KILRGVCKKIMRTFLRRISKDILTGKK	STANDARD	Antibacterial	not reported [other]	YES
8664	MYP_160110	GFKDLLKGAAKALVKTVKF	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
8665	MYP_160154	VPYGSFKHV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8666	MYP_160175	XGLXGGLLGIX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	NO
8667	MYP_160187	XTKPR	NOT STANDARD	Anticancer	Homo sapiens [Animal]	NO
8668	MYP_160188	LKKLFKKILKY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
8669	MYP_160194	GEKLKKIGKKIKNFFQKL	STANDARD	Anticancer Toxic Antimicrobial Hemolytic	not reported [other]	NO
8670	MYP_160213	QQFAVGSYVYSV	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	YES
8671	MYP_160221	RQIKIWFQNRRMKWKKAKLNAEKLKDFKIRLQYFARGGQVYIRQGRLALQGKT	STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	NO
8672	MYP_160229	RIENGLRKRLQSIYRHLEE	STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	NO
8673	MYP_160232	STDGKHWWEY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8674	MYP_160261	VYGFVRACL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8675	MYP_160266	FF	STANDARD	Anticancer Antibacterial Antiviral Antiparasitic Antimicrobial Antifungal Antiplasmodial	not reported [other]	NO
8676	MYP_160293	EEIEGKGSFTYF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8677	MYP_160320	VIFEWTLLQVLSESDQDQSLEVFLT	STANDARD	Anticancer Anti-angiogenic	not reported [other]	NO
8678	MYP_160339	MLLLTRRRST	STANDARD	Drug Delivery Vehicle Cell-penetrating peptide	not reported [other]	NO
8679	MYP_160345	RKKRRQARR	STANDARD	Cell-penetrating peptide Cargo delivery	Human immunodeficiency virus 1 [Virus]	NO
8680	MYP_160349	ILPIRSLIKKLL	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-negative	Rana nigromaculata [Animal]	YES