FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 432 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
8621	MYP_159386	FHAVELLA	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8622	MYP_159415	YHWYGYTPQNVIGGGGGRLLRRLLRRLLRK	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
8623	MYP_159433	NGRKACLNPASPIVKKIIEKMLNS	STANDARD	Antimicrobial Anticancer	Homo sapiens [Animal]	YES
8624	MYP_159438	GLLDIAGGNAETLAGHAV	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
8625	MYP_159446	LKKLAELAHKLLKLG	STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
8626	MYP_159455	KKAAKAWAKGAKKAKKLAKGAG	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
8627	MYP_159493	LLLLLIRKLIK	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
8628	MYP_159503	FLDPRPLTV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8629	MYP_159529	ASADGTVKLW	STANDARD	Anticancer	Homo sapiens [Animal]	NO
8630	MYP_159564	GRTGAGKSFL	STANDARD	Anticancer	Homo sapiens [Animal]	NO
8631	MYP_159613	LIAGLAANFLPQILCKIARKC	STANDARD	Antimicrobial Antibacterial	Clinotarsus curtipes,Odorrana andersonii,Odorrana grahami [Animal]	YES
8632	MYP_159614	YADTVRPEFY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8633	MYP_159620	IWKRWWWKR	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
8634	MYP_159623	MEVDPIGHVYIF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8635	MYP_159629	KKFFSKSMKSFFFFKK	STANDARD	Antimicrobial Anticancer	not reported [other]	NO
8636	MYP_159635	ILLWQPIPV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8637	MYP_159642	LKAAAAAAKLAAKAAKAALKAAAAAAKL	STANDARD	Anticancer	not reported [other]	NO
8638	MYP_159645	FLIGMTHGLICLISRKC	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive	Rana dybowskii [Animal]	YES
8639	MYP_159651	FFSMIPKIATGIASLVKNL	STANDARD	Defense peptide Antimicrobial Antibiotic Antifungal Anti-Candida Anti-Gram-negative Anti-Gram-positive Cytolytic Anticancer Anti-inflammatory Cytotoxic Hemolytic	Phyllomedusa trinitatis [Animal]	YES
8640	MYP_159664	FLVYGVRPGM	STANDARD	Anticancer	Homo sapiens [Animal]	NO