FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 415 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
8281	MYP_153431	YCDGFYACYMDVGGGKLLLKLLKKLLKLLKKK	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
8282	MYP_153432	FLYTLLREV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8283	MYP_153449	RIKAERKRMRNRIAASKSRKRKLERIARGC	STANDARD	Cell-penetrating peptide Cargo delivery	Homo sapiens [Animal]	YES
8284	MYP_153461	RSKKWRKIEKRVKKIFEKTKEALPVIQGVATIVGAVGR	STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
8285	MYP_153476	XVXPXVF	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	YES
8286	MYP_153490	VFKDLSVTL	STANDARD	Anticancer	Homo sapiens [Animal]	NO
8287	MYP_153494	KLWKKIEKLIKKLLTSIR	STANDARD	Anticancer	not reported [other]	NO
8288	MYP_153510	CYMEAVAL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8289	MYP_153555	YLNDHLEPWI	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8290	MYP_153627	GFLDTFKNLALNAAKSAGVSVLNSLSCKLFKTC	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	Odorrana grahami [Animal]	YES
8291	MYP_153630	RKCNFLCKLKEKLRTVITSHIDKVLRPQG	STANDARD	Antimicrobial	Yunnan spiny [Animal]	YES
8292	MYP_153657	ALNFPGSQK	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8293	MYP_153675	FKGLAKLLKIGLKALAKVIQ	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
8294	MYP_153685	FHAVELSA	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8295	MYP_153702	HHPHGHHPHG	STANDARD	Anticancer Antitumor Anti-angiogenic	not reported [other]	YES
8296	MYP_153717	LRVRLASHLR	STANDARD	Anticancer	not reported [other]	NO
8297	MYP_153747	IKLXKEXKKXLKKVLKGXIKGXIAVAKMV	NOT STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
8298	MYP_153769	FIGTALGIASAIPAIVKLFK	STANDARD	Antimicrobial Anti-Gram-positive Cytolytic Toxin Hemolytic Insecticidal Antibacterial Cytotoxic Anti-mammalian cells Anti-Gram-negative Anticancer Toxic	not reported [other]	NO
8299	MYP_153772	AYTKCSRQWRTCMTTH	STANDARD	Anticancer	not reported [other]	NO
8300	MYP_153786	RTCQSQSHRFRGPCLRRSNCANVCRTEGFPGGRCRGFRRRCFCTTHC	STANDARD	Antimicrobial Antibacterial Antifungal	Zea mays [Plant]	YES