FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 412 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
8221	MYP_152186	RWRWPIRRRPIRPPFWR	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
8222	MYP_152199	XKXPX	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	YES
8223	MYP_152221	ESLARPCAPGAPAEARL	STANDARD	PTX3 FGF2-axis antiangiogenic context	Homo sapiens [Animal]	NO
8224	MYP_152250	FHYGLTKPEESSSNPGAD	STANDARD	Aestivation Regulator	Theba pisana [Animal]	NO
8225	MYP_152271	RLQEWCSVI	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8226	MYP_152287	IFDLAGGTFDV	STANDARD	Anticancer	Homo sapiens [Animal]	NO
8227	MYP_152291	RGGRLSYSRRRFSTSTGR	STANDARD	Drug Delivery Vehicle Cell-penetrating peptide	not reported [other]	YES
8228	MYP_152320	MRPEIWAAQELDRNGDEFNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
8229	MYP_152341	GLWRALWRALRSLWKLKRKV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8230	MYP_152352	AVIDAYTEI	STANDARD	Anticancer	Homo sapiens [Animal]	NO
8231	MYP_152358	GLFDIWKKWRWRR	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
8232	MYP_152363	ATCDLLSIFNVNHAACAAHCLAIGRRGGYCNSKQVCVCR	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
8233	MYP_152380	FMPILSCSRFKRC	STANDARD	Antimicrobial Antibacterial Antifungal	not reported [other]	YES
8234	MYP_152443	GEGSGA	STANDARD	Enzyme inhibitory ACE inhibitory	Phaseolus vulgaris [Plant]	YES
8235	MYP_152455	PPVYGPE	STANDARD	Anticancer	not reported [other]	NO
8236	MYP_152457	QQHLLIAINGYPRYN	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
8237	MYP_152459	FLSLIPHIASGIASLVKNF	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	Phyllomedusa burmeisteri [Animal]	YES
8238	MYP_152485	VFMKDGFFYF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8239	MYP_152489	GIPCGESCAFLPCLTSLLGCTCQNKVCYRD	STANDARD	Antimicrobial Anticancer	Hedyotis biflora [Animal]	YES
8240	MYP_152497	DDEXEQFXYHLLSFNAV	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES