FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 41 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
801	MYP_015231	KPYQGNPTF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
802	MYP_015242	DCLSGKYKGPCAVWDNEMCRRICKEEGHISGHCSPSLKCWCEGC	STANDARD	Antimicrobial Antifungal Antiparasitic	Drosophila melanogaster [Animal]	NO
803	MYP_015245	ATCDLLSMWNVNHSACAAHCLLLGKSGGRCNDDAVCVCRK	STANDARD	Antimicrobial Antibacterial	Stomoxys calcitrans [Animal]	NO
804	MYP_015270	XVXP	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
805	MYP_015305	CGRRAGGSC	STANDARD	Anticancer	not reported [other]	NO
806	MYP_015314	FRRFFKWFRRFFKFF	STANDARD	Antimicrobial Antibacterial Antifungal	synthetic construct [Synthetic]	YES
807	MYP_015316	YGRKKRRQRRRREADFFWSLCTADMS	STANDARD	Anticancer Antimicrobial Cytotoxic Hemolytic	not reported [other]	NO
808	MYP_015318	HEHEHEHEHEHEHEHEHEHEHEHEEFGGGGGYGRRRRRRGGGGGG	STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	NO
809	MYP_015338	MRPEIWAAQEIRRFGDENNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	NO
810	MYP_015382	RVKRVWYLVIRTVIAGYNLPRAIKKK	STANDARD	Anticancer Toxin-related activity Antibacterial Antimicrobial	not reported [other]	NO
811	MYP_015455	GIWGTLAKIGIKAVPRVISMLKKKQ	STANDARD	Insecticidal Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Antifungal Anti-Gram-negative	not reported [other]	NO
812	MYP_015466	GEFLKCGESC	STANDARD	Anticancer	not reported [other]	NO
813	MYP_015477	PARAARRAARR	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
814	MYP_015521	FLIGMTQGLI	STANDARD	Anticancer	not reported [other]	NO
815	MYP_015551	AQTQRIRCRV	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
816	MYP_015569	GLFDIVKKVVGTIAGL	STANDARD	Antimicrobial Antibacterial	Litoria aurea; Litoria raniformis [Animal]	NO
817	MYP_015587	AYGLDFYIL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
818	MYP_015614	EAEQLRAYLDGTGVE	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
819	MYP_015625	XDADADKRRRRXFXKX	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
820	MYP_015641	HHHHHHHHHHHHHHHHRRRRRRRRRRRRRRR	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	NO