FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 406 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
8101	MYP_149895	MRILYLLFSLLFLALQASPGLSSPRRDMLFCKGGSCHFGGCPSHLIKVGSCFGFRSCCKWPWNA	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
8102	MYP_149911	GGVKRFKKFFRKLKKSV	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
8103	MYP_149915	DAHVLVPRTP	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
8104	MYP_149933	AAVALLPAVLLALLAPQLGKKKHRRRPSKKKRHW	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
8105	MYP_149942	CRTCNGRCQV	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
8106	MYP_149951	AEWRNGSTSSL	STANDARD	Anticancer	Homo sapiens [Animal]	NO
8107	MYP_149962	RWFRFPGRWFRF	STANDARD	Antibacterial Anti-Gram-positive Anticancer Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
8108	MYP_149983	WKKWDIPKKWK	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
8109	MYP_149990	AEVGFVRFF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8110	MYP_149996	DGRCLLIIKLAKLAKKLAKLAK	STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
8111	MYP_150002	CQLAAVC	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
8112	MYP_150006	PKRKSATKGEPA	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
8113	MYP_150010	KLFGTSGQKT	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8114	MYP_150026	SKWSECSRTCGGGVKFQER	STANDARD	Antimicrobial Anticancer	Homo sapiens [Animal]	YES
8115	MYP_150030	GIACGESCVF	STANDARD	Anticancer	not reported [other]	NO
8116	MYP_150037	KVWSDVTPL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8117	MYP_150055	EVYDGREHSA	STANDARD	Anticancer	Homo sapiens [Animal]	NO
8118	MYP_150084	YPFP	STANDARD	Opioid	Bos taurus [Animal]	NO
8119	MYP_150104	TCRSSGRYCRSPYDRRAAYCRRITDACV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
8120	MYP_150112	GFKDLLKSAAKSLVKTVLF	STANDARD	Anticancer Antitumor	synthetic construct [Synthetic]	YES