FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 402 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
8021	MYP_148298	EVTPILAIR	STANDARD	Anticancer	Homo sapiens [Animal]	NO
8022	MYP_148300	WLIDMKSLV	STANDARD	Anticancer	Homo sapiens [Animal]	NO
8023	MYP_148376	LLSHGAVIEV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8024	MYP_148397	CPRECESIC	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
8025	MYP_148421	LLGATCMFV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
8026	MYP_148464	KWVRIWIKVLRGLFVWVWFF	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
8027	MYP_148471	KSGXKHKKK	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
8028	MYP_148514	FLRHVVKILSKYL	STANDARD	Antimicrobial Antibacterial Anticancer	synthetic construct [Synthetic]	NO
8029	MYP_148526	FLSLIPSLVG	STANDARD	Anticancer	not reported [other]	NO
8030	MYP_148533	GGCYCPFRQDKCHRHCRSFGRKAGYCGNFLKRTCICVKK	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
8031	MYP_148622	INLKAIAAMAKKLL	STANDARD	Antimicrobial Antifungal Anti-Candida Anti-Gram-negative Anti-Gram-positive Cytolytic Non-hemolytic	Vespa magnifica [Animal]	YES
8032	MYP_148623	FSDTRL	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
8033	MYP_148646	SLIAAAAFCLA	STANDARD	Anticancer	Homo sapiens [Animal]	NO
8034	MYP_148658	MRPEIWFAQEARRNGDEFNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
8035	MYP_148689	XARRCSDRFRNCPADEALCGRR	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
8036	MYP_148691	LKKLCKLLKKLCKLAG	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
8037	MYP_148715	MSRTMS	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
8038	MYP_148741	FTTVCRQPRGHEAIVCGSGK	STANDARD	Anticancer	not reported [other]	NO
8039	MYP_148748	PWVPLIPI	STANDARD	Anticancer	not reported [other]	NO
8040	MYP_148750	GCRRLCWKQRCVTYCRGR	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES