FUNCTION: NEUROLOGICAL / SIGNALING > SLEEP REGULATION

Found 104 peptides

Current Node: Sleep regulation | Page 4 of 6

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
61	MYP_087847	GSSFLSPEHQKAQQRKESKKPPAKLQPR	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Cardiovascular Metabolic regulation Physiological regulation Growth regulation Development regulation Receptor modulation Sleep regulation Wake regulation Feeding regulator	Rattus norvegicus [Animal]	YES
62	MYP_089050	FNAPFDVGIKLSGVQYQQHSQAL	STANDARD	Hormonal Appetite regulation	Homo sapiens [Animal]	YES
63	MYP_089053	APEASPFIRFG	STANDARD	Neuropeptide Neuromodulator Receptor modulation Sleep regulation Wake regulation	Caenorhabditis elegans [Animal]	YES
64	MYP_095761	YPTKPDNPGEDAPAEELAKYYSALRHYINLITRQRY	STANDARD	NPY-family Neuropeptide Neuromodulator	Cyprinus carpio [Animal]	NO
65	MYP_097464	VPSAGDMMVRFG	STANDARD	Neuropeptide Neuromodulator Sleep regulation Wake regulation	Caenorhabditis elegans [Animal]	YES
66	MYP_099277	VPSAGDMMVRF	STANDARD	Neuropeptide Neuromodulator Sleep regulation Wake regulation	Caenorhabditis elegans [Animal]	YES
67	MYP_099556	EMPGVLRFG	STANDARD	RFamide Neuropeptide Neuromodulator	Caenorhabditis elegans [Animal]	YES
68	MYP_101127	NGAPQPFVRF	STANDARD	Neuropeptide Neuromodulator Receptor modulation Sleep regulation Wake regulation	Caenorhabditis elegans [Animal]	YES
69	MYP_102879	AFDRFDNSGVFSFGS	STANDARD	Sleep regulation Wake regulation Neuropeptide	Caenorhabditis briggsae [Animal]	YES
70	MYP_103787	DFRGVVDSCCRKSCSFSTLRAYCDS	STANDARD	Hormone Insulin family	Drosophila melanogaster [Animal]	YES
71	MYP_105404	AYRKPPFNGSIF	STANDARD	RFamide Neuropeptide Neuromodulator	Lucilia cuprina [Animal]	YES
72	MYP_110098	AMRNALVRFG	STANDARD	Neuropeptide Neuromodulator Receptor modulation Sleep regulation Wake regulation	Caenorhabditis elegans [Animal]	YES
73	MYP_110923	YKVNEYQGPVAPSGGFFLFRPRN	STANDARD	Neuropeptide	not reported [other]	YES
74	MYP_111141	EIGDEENSAKFPI	STANDARD	Cell-Cell Communication Hormones	not reported [other]	YES
75	MYP_111186	RQAQGWNKFRGAW	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Receptor modulation Sleep regulation Wake regulation	Drosophila melanogaster [Animal]	YES
76	MYP_111558	MAMPDEERYVRKEYNRDLLDWFNNVGVGQFSPGQVATLCRYPLILENSLGPSVPI	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Receptor modulation ACE inhibitory Sleep regulation Wake regulation	Drosophila melanogaster [Animal]	YES
77	MYP_114836	YPVKPENPGEDAPAEELAKYYSALRHYINLITRQRY	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Reproductive regulator Receptor modulation Sleep regulation Wake regulation Feeding regulator NPY-family	not reported [other]	YES
78	MYP_116093	DFDGAMPGVLRFG	STANDARD	RFamide Neuropeptide Neuromodulator	Caenorhabditis elegans [Animal]	YES
79	MYP_116841	GSSFLSPEHQKLQQRKESKKPPAKLQPR	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Cardiovascular Growth regulation Development regulation Receptor modulation Sleep regulation Wake regulation	Canis lupus familiaris [Animal]	NO
80	MYP_123056	GAMPGVLRF	STANDARD	Neuropeptide Neuromodulator Myotropic Receptor modulation Immunomodulatory Sleep regulation Wake regulation Molting regulator	Caenorhabditis elegans [Animal]	YES