FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 394 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
7861	MYP_145538	XTXCXFXRXC	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
7862	MYP_145559	GNWRKIVHKIKKAG	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
7863	MYP_145570	FLTPKKLQCV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
7864	MYP_145597	RLCSLYGCV	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
7865	MYP_145604	WLXVNX	NOT STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
7866	MYP_145605	GNNRPVYIPQPRPPHPRL	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Apis mellifera [Animal]	YES
7867	MYP_145616	LTYVSFRNL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
7868	MYP_145618	LIIFAILISHKK	STANDARD	Cell-penetrating peptide Cargo delivery	Homo sapiens [Animal]	YES
7869	MYP_145619	YLWWVNNQSL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
7870	MYP_145684	ALWKSILKNAGKAALNEINQIV	STANDARD	Antimicrobial Anticancer	not reported [other]	YES
7871	MYP_145686	YRWYGYTPQNVIGGGKLLLKLLKKLLKLLKKK	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
7872	MYP_145694	LKKKKFKLLQ	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
7873	MYP_145724	KPGPPWAAF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
7874	MYP_145726	MRPEIWIAQEFDRFGDEFNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
7875	MYP_145731	FILHAKKTRSAK	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
7876	MYP_145735	LIIFRILISHRR	STANDARD	Antimicrobial Anticancer Hemolytic	Protein derived [Animal]	YES
7877	MYP_145737	KAKAKAVSRSARAGLQFPVGRIHRHLK	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	Scylla paramamosain [Animal]	YES
7878	MYP_145745	CTKSIPPICYHLNQPF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
7879	MYP_145761	MRPEIWAAQEADRAGDEVNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
7880	MYP_145778	RRWVRRVRRVWRRVVRVVRRWVRR	STANDARD	Antimicrobial Antibacterial Anti-Gram-negative	Homo sapiens [Animal]	YES