FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 393 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
7841	MYP_145247	GGCSAFGHSCFGGHGK	STANDARD	Anticancer	not reported [other]	NO
7842	MYP_145248	MRPEIWAAQEADRIGDEFNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
7843	MYP_145252	GRFKRFRKKLKRLWHKVGPFVGPILHY	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Capra hircus [Animal]	YES
7844	MYP_145260	WPLAXEALLR	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	YES
7845	MYP_145268	KWLLKWLLK	STANDARD	Antibacterial Anti-Gram-positive Anticancer Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
7846	MYP_145283	LLRHVVKILSKYL	STANDARD	Anticancer Cytotoxic	not reported [other]	YES
7847	MYP_145287	CKLAKLAKKLAKLAK	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
7848	MYP_145296	VKRTKRGARRGLTKVLKKIFGSIVKKAVSKGV	STANDARD	Antimicrobial Antiviral	Monodelphis domestica [Animal]	YES
7849	MYP_145312	KYADYFLEV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
7850	MYP_145343	TSIVVSQTL	STANDARD	Anticancer	Homo sapiens [Animal]	NO
7851	MYP_145364	DDQSQWFSYHLSFFNSV	STANDARD	Anticancer Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
7852	MYP_145424	ANIIXPLLXPIC	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
7853	MYP_145448	ARRWPRSILDSHVRRVWR	STANDARD	Anticancer Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
7854	MYP_145454	GIXXWLHSAXXFGXXFVXXIXNS	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
7855	MYP_145458	EVQLVQSGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYY	STANDARD	Anti-angiogenic Anticancer Monoclonal antibody Anti-VEGFR2	Homo sapiens [Animal]	YES
7856	MYP_145463	CIIKKIIKKIIKK	STANDARD	Antimicrobial Anticancer	AMP [other]	YES
7857	MYP_145499	LMLQNALTTM	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
7858	MYP_145500	RRIRPRPPRLPRPRPRPLPFPRPGPRPIPRPLPFP	STANDARD	Antimicrobial Antifungal Antiparasitic	Synthetic construct [Synthetic]	YES
7859	MYP_145510	SLLSLIRKLIW	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
7860	MYP_145527	RPMQQARAQL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO