FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 366 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
7301	MYP_136033	RKRRNDLXSRFLALXDQ	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
7302	MYP_136036	CRVPCNWKKEFGADC	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
7303	MYP_136044	ILSLELMKL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
7304	MYP_136100	EYILSLEEL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
7305	MYP_136111	RWLKLNGRWLKL	STANDARD	Anticancer Toxin-related activity Antibacterial Antimicrobial	not reported [other]	NO
7306	MYP_136119	FVPYNPPRPYQSKPFPSFPGHGPFNPKIQWPYPLPNPGH	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	not reported [other]	NO
7307	MYP_136141	WTP	STANDARD	Anticancer	not reported [other]	NO
7308	MYP_136148	WLXXNG	NOT STANDARD	Antimicrobial Antibacterial Antifungal	Streptomyces nov. sp. MST-115088 [Bacterium]	YES
7309	MYP_136161	KSCCPNTTGRNIYNACRLTGAPRPTCAKLSGCKIISGST	STANDARD	Anticancer Antibacterial Antimicrobial	not reported [other]	NO
7310	MYP_136162	XACRRSRRGCGRRSRRCG	NOT STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	NO
7311	MYP_136166	TPTVPSSSF	STANDARD	Anticancer	Homo sapiens [Animal]	NO
7312	MYP_136204	WNWSKSF	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
7313	MYP_136205	GYCFTACYLRNGVRACYRRCN	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
7314	MYP_136207	FKRIVQRIKDFLRNLV	STANDARD	Antibacterial Antimicrobial	Pan troglodytes [Animal]	YES
7315	MYP_136242	KWKSFIKKLTSKFLHSAKKS	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
7316	MYP_136250	GSDIMSFVI	STANDARD	Anticancer	Homo sapiens [Animal]	NO
7317	MYP_136278	FFGWLIKGAIHAGKAIHGLIH	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
7318	MYP_136285	FHAAELLA	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
7319	MYP_136337	GRKKRRQRRRPPQC	STANDARD	Cell-penetrating peptide Cargo delivery	Human immunodeficiency virus 1 [Virus]	NO
7320	MYP_136382	NLDEEKQLLY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO