FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 360 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
7181	MYP_133925	FFSDK	STANDARD	Antimicrobial Antibacterial	Bos taurus [Animal]	NO
7182	MYP_133960	NTYASPRFK	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
7183	MYP_133987	TWLPLPR	STANDARD	Neuroprotector Apoptosis Regulator	Juglans mandshurica [Plant]	NO
7184	MYP_133993	KLGVPLKRK	STANDARD	Antimicrobial Antifungal	synthetic construct [Synthetic]	YES
7185	MYP_134010	XCSHLDASPFQRP	NOT STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
7186	MYP_134041	QVLKKVRTWYRKAFHVIGKV	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	YES
7187	MYP_134065	ADVESSQKKNGYAKKIDCGSACVARCRLSRRPRLCHRACGTCCYRCNCVPPGTYGNYDKCQCYASLTTHGGRRKCP	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
7188	MYP_134067	GPTPNTGAAL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
7189	MYP_134087	QLLLLIRKLIV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
7190	MYP_134107	RQYPTPFQL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
7191	MYP_134122	LLKLKFKKKQ	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
7192	MYP_134126	AARAVFLAL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
7193	MYP_134142	LRPWECSPKCAGRCSNTQYKKACLTFCNKCCAKCLCVPPGTYGNKGACPCYNNWKTKEGGPKCP	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
7194	MYP_134146	AGYXLGKINLKALAALAKKIL	NOT STANDARD	Antimicrobial Anticancer	Protein derived [Animal]	NO
7195	MYP_134151	WHSDMEWWYLLG	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
7196	MYP_134156	GLYDGMEHL	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	YES
7197	MYP_134200	WL	STANDARD	Antihypertensive ACE inhibitory	Glycine max [Plant]	YES
7198	MYP_134208	RQNSCTYSDARRWALCWSGE	STANDARD	Anticancer	not reported [other]	NO
7199	MYP_134220	LIIFRILISH	STANDARD	Drug Delivery Vehicle Cell-penetrating peptide	not reported [other]	NO
7200	MYP_134287	CPKILKKCRRDSDCPGACICRYWKVCGSGSDGGV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO