FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 355 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
7081	MYP_131677	GWFKKTFHKVSHAVKSGIHAGQRGCSALGF	STANDARD	Antimicrobial	Strongylocentrotus droebachiensis [other]	YES
7082	MYP_131680	YLYDRLLRV	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	YES
7083	MYP_131691	ADGAPRPGAPLA	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
7084	MYP_131694	MIHTNHWWAQD	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
7085	MYP_131700	CGNSNPKSC	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
7086	MYP_131733	FLRNFSLML	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
7087	MYP_131764	GIGALSAKGALKGLAKGLAQHFAN	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
7088	MYP_131769	TEFPIIKMY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
7089	MYP_131802	MRPEIWAAQEIDRDGDENNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
7090	MYP_131820	ASVVKWLWKWVWKLLK	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
7091	MYP_131821	XXXSXXFXLXPA	NOT STANDARD	GnRH antagonist Endocrine Anticancer	Homo sapiens [Animal]; synthetic construct [Synthetic]	YES
7092	MYP_131845	FKWKSVLKIVDIFVDIYF	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
7093	MYP_131861	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Antifungal Hemolytic	Phyllomedusa bicolor [Animal]	YES
7094	MYP_131865	KYVGIEREM	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
7095	MYP_131868	DXXPLAXEALLR	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	YES
7096	MYP_131869	FLSLIPKIISAISALINHF	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
7097	MYP_131896	AKKVVKKIYKRFQK	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
7098	MYP_131897	KYDCFLHPF	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
7099	MYP_132004	SNDGPTLI	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
7100	MYP_132042	LVPRGSRAGSPSGGPFCALARQPLTGARLMSGLFFALHET	STANDARD	Anticancer Anti-angiogenic	not reported [other]	NO