FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 353 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
7041	MYP_130703	GGGGGGGRGDLPETGGS	STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
7042	MYP_130751	SNDIYFNFQR	STANDARD	Antimicrobial Antifungal Anticancer Antiviral Cytotoxic Anti-HIV	Phaseolus vulgaris [Plant]	YES
7043	MYP_130765	RWLKLPGRWLKL	STANDARD	Anticancer Toxin-related activity Antibacterial Antimicrobial	not reported [other]	NO
7044	MYP_130826	RRPKGRGKRRREKQRPTDCHLCGDAVPRR	STANDARD	Anti-angiogenic	Homo sapiens [Animal]	NO
7045	MYP_130854	RRWQWRRRWQWRKXC	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Bovine Lactoferricin [Animal]	YES
7046	MYP_130884	CRQIKIWFPNRRMKWKKC	STANDARD	Drug Delivery Vehicle Cell-penetrating peptide	not reported [other]	YES
7047	MYP_130899	MRPEIWFAQEIRRNGDENNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
7048	MYP_130917	DDTPSSRCGSGGWGPCLPIVDLLCIVHVTVGCSGGFGCCRIG	STANDARD	Antimicrobial Anti-Gram-negative Non-hemolytic	Pelodiscus sinensis [other]	YES
7049	MYP_130936	VAKLLAKALKKLL	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
7050	MYP_130939	PSLTGHGFHGVYD	STANDARD	Immunomodulatory Antiviral Antitumor	synthetic construct [Synthetic]	YES
7051	MYP_130944	ISKRILTGKK	STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
7052	MYP_130958	GIPCGESCVFIPCLTSAIGCSCKSKVCYRN	STANDARD	Antimicrobial Anticancer	Viola philippica [Plant]	YES
7053	MYP_130960	ISGGNDKQGFPM	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
7054	MYP_130969	DLWIRETLTSPKSLID	STANDARD	Anticancer Anti-angiogenic	not reported [other]	NO
7055	MYP_130970	MRPEIWFAQEARRDGDENNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
7056	MYP_130990	PIPIFPY	STANDARD	Antimicrobial Anticancer Cytotoxic	Phakellia costata,Stylotella aurantium [Animal]	YES
7057	MYP_130992	XACSGSGSGCGSGSGSCGRRRRRRRR	NOT STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
7058	MYP_131018	AKYLMELTM	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
7059	MYP_131029	VFCNSFGGCTNI	STANDARD	Neuropeptide	Sepia officinalis [Animal]	NO
7060	MYP_131057	KAMQDAEVSKSDIGEVI	STANDARD	Anticancer	synthetic construct [Synthetic]	YES