FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 343 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
6841	MYP_127096	VTCDLLSIKGVAEHSACAANCLSMGKAGGRCENGVCLCRKTNFKDLWDKRF	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
6842	MYP_127117	SCVWIPCISAALGCSCKNKVCYRNGIPCGE	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
6843	MYP_127133	VNNALKKLLGKLLKVVK	STANDARD	Anticancer	Insecta [Animal]	YES
6844	MYP_127142	GMHLLITGL	STANDARD	Anticancer	Homo sapiens [Animal]	NO
6845	MYP_127170	VTEESFDSKFY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6846	MYP_127188	TNXYANXEKLLR	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	YES
6847	MYP_127203	QDGMYQRFLRQHVHPEETGGSDRYSNLMMQRRKMTLYHSKRFNTFIH	STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
6848	MYP_127222	CLKKLLKLLKKLLKLCLEELLHHLEELLHH	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6849	MYP_127230	IKKILSKIKKLLK	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
6850	MYP_127233	CLNEYHLFL	STANDARD	Anticancer	Homo sapiens [Animal]	NO
6851	MYP_127234	IPCGESCVWIPCISGMFGCSCKDKVCYS	STANDARD	Antimicrobial Antibiotic Defense peptide Cytolytic Cytotoxic Hemolytic	Chassalia chartacea [Plant]	YES
6852	MYP_127246	MRPEIWIAQEIDRIGDEVNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
6853	MYP_127250	ILHNGAYSL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
6854	MYP_127305	PTPFIFS	STANDARD	Antimicrobial Anticancer	Phakellia costata [Animal]	YES
6855	MYP_127312	KXCKXC	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	YES
6856	MYP_127325	KASYQSL	STANDARD	Anticancer Targeting	synthetic construct [Synthetic]	YES
6857	MYP_127442	VVDEDHELIY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6858	MYP_127444	ILKKWWGTSGGLLGGLLGKVTSVIKGLNNI	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6859	MYP_127450	GLIQLVEGV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
6860	MYP_127466	KAFWGLQH	STANDARD	Anticancer	not reported [other]	NO