FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 342 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
6821	MYP_126805	KXCKXCKXC	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	YES
6822	MYP_126806	VWKPPYLPRPRPPRRIYNR	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
6823	MYP_126823	MRPEIWAAQELRRNGDENNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
6824	MYP_126857	EARPALLTSRLRFIPK	STANDARD	Cell-penetrating peptide Cargo delivery	not reported [other]	YES
6825	MYP_126858	FIGTLIPLALGALTKLFK	STANDARD	Antimicrobial Anticancer Antiparasitic	Boana raniceps [Animal]	YES
6826	MYP_126861	VKLFPWWNQY	STANDARD	Antiparasitic Antimicrobial Antiplasmodial	not reported [other]	YES
6827	MYP_126869	CGTKRKC	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6828	MYP_126870	CPLCNGRCAL	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
6829	MYP_126877	FFPFIGGFFKGFF	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
6830	MYP_126898	MTLPVDAVISV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6831	MYP_126901	GLGDKFGESIVNANTVLDDLNSRMPQSRHDIQQL	STANDARD	Cell-penetrating peptide Cargo delivery	not reported [other]	YES
6832	MYP_126919	WKKIPKFLHLLKKF	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Anticancer	synthetic construct [Synthetic]	YES
6833	MYP_126927	GIPCGESCVFIPCLTTVAGCSCKNKVCYRN	STANDARD	Antimicrobial Antiviral Cytotoxic Anticancer	Leonia cymosa [Animal]	YES
6834	MYP_126945	FLGALFHALS	STANDARD	Anticancer	not reported [other]	NO
6835	MYP_126952	INLKKLAKLXKKIL	NOT STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	YES
6836	MYP_126998	SAELPGLYSSGEE	STANDARD	Neuropeptide	Taeniopygia guttata [Animal]	NO
6837	MYP_127015	GLFVGLAKVA	STANDARD	Anticancer	not reported [other]	NO
6838	MYP_127020	AIGSILGALA	STANDARD	Anticancer	not reported [other]	NO
6839	MYP_127030	KKLFKKILKKL	STANDARD	Hemolytic	synthetic construct [Synthetic]	YES
6840	MYP_127073	VDKPPYLPRPRWQRRIYNR	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES