FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 336 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
6701	MYP_124752	CWMSPRHLGTCGRKKRRQRRRPPQ	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
6702	MYP_124758	VDCRRSEGFCQEYCNYMETQVGYCSKKKDACC	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
6703	MYP_124800	LFGLIPSLIGGLVSAFK	STANDARD	Antimicrobial	Lychas mucronatus [Animal]	YES
6704	MYP_124807	GGKKLFKKILKYL	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
6705	MYP_124837	RRWCVYAYVRVRGVRVYAYVCW	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
6706	MYP_124854	SYTRLFLIL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
6707	MYP_124855	WLQYFPNPV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
6708	MYP_124867	WLEPAYQRFL	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
6709	MYP_124884	KNAWKHSSCHHRHQI	STANDARD	Drug Delivery Vehicle Cell-penetrating peptide	not reported [other]	YES
6710	MYP_124890	FSIPEGALVAV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6711	MYP_124905	KPFSSFTSM	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6712	MYP_124906	CGESCVWIPCISSAIGCSCKSKVCYRNGIP	STANDARD	Antimicrobial Antibacterial Antifungal Antiviral Anticancer Cytotoxic	Viola odorata [Plant]	YES
6713	MYP_124934	RRWXRRXRRXWRRXXRXXRRWXRR	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6714	MYP_124936	NVLLWX	NOT STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
6715	MYP_124943	TCRSSGRYCRSPYDRAARYCRRITDACV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6716	MYP_124989	LTVSPWYGCGQLGKKKHRRRPSKKKRHW	STANDARD	Anticancer	not reported [other]	NO
6717	MYP_125017	LILSSGELLRHPRG	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
6718	MYP_125033	KKKKKFLLLQ	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
6719	MYP_125042	SCVFIPCISTLLGCSCKNKVCYRNGVIPCGE	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
6720	MYP_125061	RRRRRHHH	STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES