FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 328 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
6541	MYP_121575	FAKLLAKLAKKAL	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
6542	MYP_121606	ALMDKSLHV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
6543	MYP_121623	CGESCVWIPCLTSVFNCKCENKVCYHDKIP	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial Antiviral	not reported [other]	NO
6544	MYP_121629	LPGMMG	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
6545	MYP_121704	VWKWGKLGKLLKLGKLGK	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6546	MYP_121733	GFCGYACYYRNGVRICVRYCN	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
6547	MYP_121736	EEADFLLAY	STANDARD	Anticancer	Homo sapiens [Animal]	NO
6548	MYP_121744	GFLDIINKLGKTFAGHMLDKIKCTIGTCPPSP	STANDARD	MeX pooled-growth screened peptide Antimicrobial Antibacterial	Lithobates catesbeianus [Animal]	YES
6549	MYP_121839	XVXPPI	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
6550	MYP_121850	FAKLLAKALK	STANDARD	Anticancer	not reported [other]	NO
6551	MYP_121856	RAPYDRRRRY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6552	MYP_121904	PFKLSKH	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
6553	MYP_121945	VSVQIISCQY	STANDARD	Anticancer	Homo sapiens [Animal]	NO
6554	MYP_121954	FLPKVKKLLEKLL	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
6555	MYP_122003	RVKLVNLXFATLRFXVP	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6556	MYP_122045	KWKLFKKIPK	STANDARD	Anticancer	not reported [other]	NO
6557	MYP_122078	ETSKQVTRW	STANDARD	Anticancer	Homo sapiens [Animal]	NO
6558	MYP_122094	GSIPACGESCFKGKCYTPGCSCSKYPLCAKN	STANDARD	Antimicrobial	not reported [other]	NO
6559	MYP_122134	GLPTCGETCFGGTCNTPGCTCDPWPVCTHN	STANDARD	Antiviral Insecticidal Hemolytic	Viola odorata [Plant]	NO
6560	MYP_122189	RQIKIWFQNRRMKWKK	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES