FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 324 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
6461	MYP_120286	RPEIWITQELRRIGDEINAYYAR	STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
6462	MYP_120297	KWKKLLKKLLKLLKKLLK	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
6463	MYP_120335	GLFDVIKKVASVIGGL	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
6464	MYP_120362	SRPRR	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
6465	MYP_120374	RVIKKNFEFQKYGISVGKKIGNAVIRNKVKRQIRMIGDIIILSKLL	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
6466	MYP_120389	FLPKVKKLLSELL	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
6467	MYP_120426	CASNNGRVVL	STANDARD	Anticancer	not reported [other]	NO
6468	MYP_120442	DTLRLRI	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
6469	MYP_120490	MPFATPMEA	STANDARD	Anticancer	Homo sapiens [Animal]	NO
6470	MYP_120496	AAIAASRSV	STANDARD	Anticancer	Homo sapiens [Animal]	NO
6471	MYP_120503	XARCSDRFRNCPADEALCGR	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
6472	MYP_120506	VKRKKKPALWKTLLKKVLKA	STANDARD	Drug Delivery Vehicle Cell-penetrating peptide	not reported [other]	YES
6473	MYP_120525	RTVGGMATHWTCACPTPHDEERVNNPVDK	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
6474	MYP_120527	GLPTCGETCFKGKCYTPGCSCSYPICKKD	STANDARD	Antimicrobial Antibacterial Anticancer Cytotoxic Anti-Gram-negative	Melicytus latifolius [Plant]	YES
6475	MYP_120528	WKIVFWWRR	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
6476	MYP_120530	GGVCPKILQRCRRDSDCPGACICRGNGYCGSGSD	STANDARD	Antimicrobial Antibacterial Antifungal Anticancer Cytotoxic Protease inhibitor Anti-Gram-negative	Momordica cochinchinensis [Plant]	YES
6477	MYP_120551	SLGSPVLGL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
6478	MYP_120566	CYVELHC	STANDARD	Anticancer	not reported [other]	NO
6479	MYP_120576	FKKFRKF	STANDARD	Antimicrobial Anticancer	Protein derived [Animal]	YES
6480	MYP_120579	LRMTCAFGVAQRSADCALSS	STANDARD	Anticancer	not reported [other]	NO