FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 321 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
6401	MYP_119047	CPRSKIKDCVKGYCRCVRKK	STANDARD	Predicted/benchmark label: Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Antifungal Anti-Gram-negative	not reported [other]	NO
6402	MYP_119209	EYCLKFTKL	STANDARD	Predicted/benchmark label: Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
6403	MYP_119220	ILTVILGVL	STANDARD	Predicted/benchmark label: Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
6404	MYP_119231	VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive	Carnobacterium maltaromaticum [Bacterium]	YES
6405	MYP_119248	FLKKLMGVIASLF	STANDARD	Antibacterial Antimicrobial Antifungal Anticancer	synthetic construct [Synthetic]	YES
6406	MYP_119274	HRDVQPTL	STANDARD	Anticancer Antitumor	Camelus dromedarius [Animal]	NO
6407	MYP_119287	FLPLIAGLAANFLPKIFCAITKKC	STANDARD	Antimicrobial Antibacterial Antifungal	not reported [other]	NO
6408	MYP_119312	ELQSTGRKVA	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6409	MYP_119340	AENPESILDSHVQSVM	STANDARD	Anticancer Antimicrobial Antibacterial	synthetic construct [Synthetic]	NO
6410	MYP_119342	AGYLLGKINLKKLAKLLLIL	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
6411	MYP_119358	MXPMPP	NOT STANDARD	Anticancer Toxin	not reported [other]	NO
6412	MYP_119362	FFPKVAGVAAKVLKKFCTISKKC	STANDARD	Antibacterial Antimicrobial Antifungal Anticancer	synthetic construct [Synthetic]	YES
6413	MYP_119383	IVRRADRAAVP	STANDARD	Cytotoxic Anticancer	synthetic construct [Synthetic]	YES
6414	MYP_119435	HLSTAFARV	STANDARD	Predicted/benchmark label: Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
6415	MYP_119464	ETEQTKFWDY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6416	MYP_119474	GDVIDTDRDIDR	STANDARD	Predicted/benchmark label: Anticancer Anti-angiogenic	not reported [other]	NO
6417	MYP_119477	WELVVLGKYGRKKRRQRRR	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
6418	MYP_119503	GGFG	STANDARD	Anticancer	Synthetic construct [Synthetic]	NO
6419	MYP_119512	SWKSMAKKLKEYMEKLKQRA	STANDARD	Anti-Gram-positive Antibacterial Antifungal Antiviral Anticancer Antimicrobial	Lachesana tarabaevi [Animal]	YES
6420	MYP_119534	MTEEY	STANDARD	Cytotoxic Antiproliferative Anticancer	Phaseolus vulgaris [Plant]	YES