FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 320 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
6381	MYP_118694	GRKKRRQRRRGGWMWVTNLRTD	STANDARD	Antimicrobial Antibacterial Antifungal	synthetic construct [Synthetic]	YES
6382	MYP_118697	NQGRHFCGGALIHARFVMTAAHCFQ	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
6383	MYP_118719	XXXAXLX	NOT STANDARD	Antimicrobial Anticancer	Streptomyces atratus MJM3502 [Bacterium]	NO
6384	MYP_118740	KWKLFKKIGIGKFLHLAKKF	STANDARD	Anticancer Antibacterial Antimicrobial	synthetic construct [Synthetic]	NO
6385	MYP_118766	KILILIKRK	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
6386	MYP_118778	KYLKLSSSEL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
6387	MYP_118834	IAQELRRIGDEF	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
6388	MYP_118892	TMPFLFCNVNDCNFASRNDYSYWL	STANDARD	Anti-angiogenic	Homo sapiens [Animal]	YES
6389	MYP_118911	FFSLIPKLVGKLIKAFK	STANDARD	Antibiofilm Biofilm inhibition Cytotoxic Anti-proliferative	not reported [other]	NO
6390	MYP_118946	GWYEIIKKIYKWLK	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6391	MYP_118951	FVFCALLLV	STANDARD	Anticancer	Homo sapiens [Animal]	NO
6392	MYP_118956	GGCLQILPTLSECFGR	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
6393	MYP_118965	YARAARRAARR	STANDARD	Drug Delivery Vehicle Cell-penetrating peptide	synthetic construct [Synthetic]	YES
6394	MYP_118979	MKNYSKNATHLITVLLFSFVVILLIIPSKCEAVSNDRQSLEARSADLVPEPRYIIDVPPRCPPGSKFIKNRCRVIVP	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
6395	MYP_118982	FFGSVLKVAAKVLPAALCQIFKKC	STANDARD	Anticancer	not reported [other]	NO
6396	MYP_118985	PLANSIWNV	STANDARD	Anticancer	Homo sapiens [Animal]	NO
6397	MYP_119030	QYDPTPLTW	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
6398	MYP_119039	CAGAGTGGGAGAGGCAAGAC	STANDARD	Predicted/benchmark label: Anticancer	not reported [other]	NO
6399	MYP_119043	RYPAGLPFL	STANDARD	Predicted/benchmark label: Anticancer	not reported [other]	NO
6400	MYP_119044	GGGWGQPHVGG	STANDARD	Antimicrobial Anticancer Antiviral	Tragelaphus strepsiceros [Animal]	NO