FUNCTION: DELIVERY / TARGETING

Found 2,578 peptides

Current Node: Delivery / Targeting | Page 30 of 129

Level 2 Subcategories

Drug delivery vehicle (2152) Barrier transport (0) Cell penetration (0) Targeting ligand (0) Tumor targeting (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
581	MYP_039497	KLWMRWYSPTTRRYG	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	NO
582	MYP_039562	IDLMQAR	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
583	MYP_039630	GANNNRPVYIPRPRPPHPRL	STANDARD	Drug delivery BBB shuttle	not reported [other]	NO
584	MYP_039688	RHTVCRVSLSSVQGSCSHEY	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
585	MYP_039697	LCLQ	STANDARD	Antimicrobial Anticancer	Protein derived [Animal]	NO
586	MYP_039704	GNGRAHA	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
587	MYP_039709	CYFQNCPRG	STANDARD	Neurohypophyseal hormone Neuropeptide	Cavia porcellus [Animal]	NO
588	MYP_039725	CRVSRQNKC	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
589	MYP_039743	TNHRPPMWSPVWP	STANDARD	Drug delivery BBB shuttle	not reported [other]	NO
590	MYP_039774	WAGGDASGE	STANDARD	Behavior Regulator	Oryctolagus cuniculus [Animal]	NO
591	MYP_039794	EVNXVAEFXXD	NOT STANDARD	Targeting	synthetic construct [Synthetic]	NO
592	MYP_039881	LVCLPPSCE	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
593	MYP_039949	VRLPPP	STANDARD	Drug Delivery Vehicle Cell-penetrating peptide	not reported [other]	NO
594	MYP_039954	RQGAARVTSWLGRQLRIAGKRLEGRSK	STANDARD	Drug Delivery Vehicle Cell-penetrating peptide	not reported [other]	NO
595	MYP_040069	SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII	STANDARD	Analgesic Pronociceptive Hormone Endocrine Neuropeptide Neuromodulator Cardiovascular Metabolic regulation Physiological regulation Reproductive regulator Growth regulation Development regulation Receptor modulation	Mus musculus [Animal]	YES
596	MYP_040101	CIRSAVSC	STANDARD	Anticancer	not reported [other]	NO
597	MYP_040124	GLFEAIEGFIENGWEGMIDGWYGGGGRRRRRRRRRK	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	YES
598	MYP_040161	CGRKKRXRQRRRPPQ	NOT STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	YES
599	MYP_040291	GLFEALLELLESLWELLLEA	STANDARD	Cell-penetrating peptide	synthetic construct [Synthetic]	YES
600	MYP_040370	YGRKKRRQRRRVIKPLTKSYQGSGK	STANDARD	BBB shuttle Drug delivery	not reported [other]	NO