FUNCTION: ANTICANCER

Found 13,621 peptides

Current Node: Anticancer | Page 3 of 682

Level 2 Subcategories

Cytotoxic anticancer activity (8360) Tumor Homing Peptide (659) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (27) tumor necrosis factor family (19) Anti-breast cancer (9) Prostate cancer targeting (2) Anti-angiogenic activity (1) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
41	MYP_000566	ECTHSGGACNSHTQCCDDFCSTATSTCI	STANDARD	Toxic Cytotoxic	not reported [other]	NO
42	MYP_000573	AYCCHPVCGKNFDC	STANDARD	Toxic Cytotoxic	not reported [other]	NO
43	MYP_000588	RIPLEM	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
44	MYP_000592	YGRKKRRQRR	STANDARD	Anticancer	not reported [other]	NO
45	MYP_000599	LLALLMAGL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
46	MYP_000608	GWFKKTFHKVSHAVKSGIHA	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
47	MYP_000610	GIMSSLMKKAAAHIAK	STANDARD	Antimicrobial Anticancer	AMP [other]	YES
48	MYP_000624	FLFSLIPSAISGLISAF	STANDARD	Antibacterial Toxic Antimicrobial Antifungal Anti-Gram-positive Cytotoxic	not reported [other]	YES
49	MYP_000632	DLVKWIIDTVNKFTKK	STANDARD	Cytolytic	synthetic construct [Synthetic]	YES
50	MYP_000648	KMICKTRVDCKKYRCPRSKI	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Antifungal Anti-Gram-negative	not reported [other]	NO
51	MYP_000658	IALNFPGSQK	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
52	MYP_000663	GCCSHPACAGNNPHICS	STANDARD	Toxic Cytotoxic	not reported [other]	YES
53	MYP_000674	XGLFGXGRKKRRQRRRPPQ	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	Protein derived [Animal]	YES
54	MYP_000682	DCGGQGKGCYTQPCCPGLRCRGGGTGGGVCQP	STANDARD	Toxic Cytotoxic	not reported [other]	YES
55	MYP_000689	RQIKIQFQNRRMKWKKKAYARIGNSYFK	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
56	MYP_000694	APAGLVAKFGRPIVKKYYKQIMQFIGEGSAINKIIPWIARMWRT	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive	Enterococcus faecalis RJ-11 [Bacterium]	YES
57	MYP_000711	KRWRWRW	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
58	MYP_000715	RQIAIWFQNRRMKWKK	STANDARD	Drug Delivery Vehicle Cell-penetrating peptide	not reported [other]	YES
59	MYP_000716	IGGYCSWLRL	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Harmonia axyridis [Animal]	YES
60	MYP_000725	SLLQFNKMIKFETRKNAIPFYAF	STANDARD	Toxic Cytotoxic	not reported [other]	NO