FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 291 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
5801	MYP_108088	KRKRKILILIKRK	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
5802	MYP_108115	MRPEIWFAQEADRNGDEFNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
5803	MYP_108118	AGYLMELCM	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
5804	MYP_108129	IMNDMPIYM	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
5805	MYP_108132	GFGMALKLXKKVL	NOT STANDARD	Anticancer Antimicrobial Antifungal	not reported [other]	NO
5806	MYP_108134	ILKKLLSTAAGLLSNL	STANDARD	Hemolytic	synthetic construct [Synthetic]	YES
5807	MYP_108147	GINASVVNIQKEIDRLNEVAKNLNESLIDL	STANDARD	Antimicrobial Antiviral	synthetic construct [Synthetic]	YES
5808	MYP_108153	GARECESGGPGMRKLCTQIN	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
5809	MYP_108158	RRLFRRILRRL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
5810	MYP_108171	KWKSFIKKLTSKFLHSAKKM	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
5811	MYP_108184	TTINYTLWR	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
5812	MYP_108206	MKTQFVILIVAVVLLQLISHSEAFLGALWNVAKSVFGKRGLRNFDDLDDTFEPEMSEADLKYLQDLLR	STANDARD	Antimicrobial Antibiotic Antiparasitic Antiplasmodial Cytolytic Anticancer Cytotoxic Hemolytic	Vaejovis mexicanus smithi [Animal]	NO
5813	MYP_108210	LSQETFSDLWKLLPEN	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
5814	MYP_108216	ITIGVLARV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
5815	MYP_108230	LNLKALLAVAKKIL	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Anticancer Antifungal	Vespa crabro [Animal]	YES
5816	MYP_108236	LTYQTWP	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
5817	MYP_108248	FPWWNQYVKL	STANDARD	Antimicrobial Antibacterial Antiparasitic Antiprotozoal	Bacillus aneurinolyticus [Bacterium]; Bacillus brevis [Bacterium]	YES
5818	MYP_108302	NTQITDIGRY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
5819	MYP_108397	FMPIIGRLMSGSL	STANDARD	Antimicrobial	Vespine wasp [Animal]; Insecta [Animal]	NO
5820	MYP_108458	GLFDIVKKIKSLF	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO